KEGG   Setaria italica (foxtail millet): 101764484Help
Entry
101764484         CDS       T02818                                 

Definition
(RefSeq) transcription factor DIVARICATA
Organism
sita  Setaria italica (foxtail millet)
SSDB OrthologParalogGFIT
Motif
Pfam: Myb_DNA-binding Myb_DNA-bind_6 Myb_DNA-bind_7 SLIDE TEA
Motif
Other DBs
NCBI-GeneID: 101764484
NCBI-ProteinID: XP_004968168
UniProt: K3XKK3
Position
V
AA seq 294 aa AA seqDB search
MMREAYMEVLPPMDHIGSRNGWYHPAVRTWTPQENKLFERALAGVDLRCPDWEQVARAIP
GRTVREVVHHFKSLEVDVQQIESGMVPIPFYGGGGGGSFTLQWDGNGGGGPGDFRHAYRF
GGGCGKRHPGRTPEQERKKGVPWTEEEHKLFLLGLKKYGKGDWRNISRNFVQTRTPTQVA
SHAQKYFIRLNSGGKDKRRSSIHDITTVNLTDDQPPSPSQSSLITNQSNASAPATAVGQF
SLSADTKQHGAANLPFNSPSRTPGMPTYGMGLQDQGLQCGPLHDQLVGNQSMLF
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgcgaggcgtatatggaggtgctgccaccgatggatcacataggctcgcggaac
ggctggtatcatccggccgtgcgcacctggacgccgcaggagaacaagctgttcgagcgg
gcgctcgccggcgtcgacctccgctgtccggactgggagcaagtggcgcgggccatcccc
ggcagaacggtccgcgaggtcgtccaccacttcaagagcctcgaggtcgacgtccagcag
atcgagagcggcatggtgcccatcccgttctacggcggcggcggcggcggctcgttcacc
ctgcagtgggacggcaatggcggcggcggcccaggggacttcaggcacgcgtaccggttc
ggcggaggctgcgggaagcggcaccccggccgcacgccggagcaggagaggaagaagggc
gtgccatggaccgaggaggagcacaagttgtttctcttaggcctgaagaagtatggcaaa
ggggattggaggaacatatcccgcaacttcgttcagacgaggacgcctactcaagtggcc
agtcatgcgcagaagtacttcatcaggctcaactccggaggcaaggataagagaagatca
agcatccacgacatcaccacagttaacctgacggatgaccagcctccgtcgccatcacag
tcctctctgatcaccaaccagtccaacgcatcagctccggccacagcagtaggccaattc
tcattgtcagcagacaccaagcaacatggcgctgcgaatttgccgttcaattcaccaagc
cggactcctggaatgccaacttatgggatgggtttgcaagatcaaggtctgcagtgtggc
cctctacatgatcagctggttggcaaccaaagcatgctgttttag

DBGET integrated database retrieval system