KEGG   Setaria italica (foxtail millet): 101765184Help
Entry
101765184         CDS       T02818                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase FKBP12
  KO
K01802  peptidylprolyl isomerase [EC:5.2.1.8]
Organism
sita  Setaria italica (foxtail millet)
Brite
KEGG Orthology (KO) [BR:sita00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    101765184
Enzymes [BR:sita01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     101765184
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C
Motif
Other DBs
NCBI-GeneID: 101765184
NCBI-ProteinID: XP_004953995
UniProt: K3YWW3
Position
I
AA seq 112 aa AA seqDB search
MGFEKEILRDGTGPKPTKGQKVTVHCTGYGKDRDLSKKFWSTKDPGQQPFSFNIGLGSVI
KGWDEGVMTMQVGEVARIQCTPDYAYGANGFSAWGIQPNSVLVFEIEVISAQ
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atgggcttcgagaaggagatcctgagagacggcaccggccccaagccaacaaagggccag
aaggtcaccgtccactgcaccggctacgggaaggatcgtgatctatccaagaagttttgg
agcaccaaggacccagggcagcagccattcagtttcaacattggtttgggttcagtgatc
aaaggctgggatgagggagttatgaccatgcaagtgggtgaagttgctcgtatccagtgc
accccggactatgcttatggagccaatggattttcagcctggggaattcaaccgaactcg
gtgctggtgttcgagattgaagtcatcagtgcccagtaa

DBGET integrated database retrieval system