KEGG   Setaria italica (foxtail millet): 101765240Help
Entry
101765240         CDS       T02818                                 

Definition
(RefSeq) beta-glucosidase 22
  KO
K01188  beta-glucosidase [EC:3.2.1.21]
Organism
sita  Setaria italica (foxtail millet)
Pathway
sita00460  Cyanoamino acid metabolism
sita00500  Starch and sucrose metabolism
sita00940  Phenylpropanoid biosynthesis
sita01100  Metabolic pathways
sita01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sita00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101765240
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    101765240
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    101765240
Enzymes [BR:sita01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     101765240
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-GeneID: 101765240
NCBI-ProteinID: XP_012700105
UniProt: K3Z5D5
Position
III
AA seq 525 aa AA seqDB search
MGAPARSICRHVLLILLSLQLLLVAPWQGGTAARALNFTRQDFPRDFVFGAGTSAYQYEG
ATDEDGRSPSIWDTFTHAGRMPDKSTGDLGAGGYHKYKEDVKLMSDTGLEAYRFSISWSR
LIPRGRGPINPKGLEYYNNLINELVKRGIEIHVTLYHLDFPQILEDEYHGWLSPRVVEDF
AAYADACFREFGDRVKHWTTMDEPNVISIAAYDNGAFPPCRCSPPFGINCTEGNSSVEPY
IVGHNSILAHAAAVRLYREQYQATQKGVVGMNVYSIWNYPFSTSPADMAATRRSMDFMIG
WIINPLVYGDYPETMKRIVGSRLPKFTKEQSEMIRGTADFIGINHYTSVYVSDRSNSADT
GPRDYNGDVAATFRFSRNDPPTGQFIPINMPTDPQGLQCMLEYLSNTYKNVAVYVQENGY
GAFFNDSIEDHKRVEYLSGYIGSTLTALRNGANVKGYFVWSFLDVFELLAGYYSRYGLYH
VDFKDPELPRQPKLSAHWYSKFLKSEIGINIESTTNTDGGSHAAQ
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgggggcccctgctcgtagtatctgcaggcacgtcctcctcatcctcctgtcgctgcag
ctgcttcttgtggcgccatggcagggcgggacggcagctcgagctctcaacttcacgagg
caggatttccccagggacttcgtctttggggcaggcacatcagcgtatcagtacgagggg
gcaaccgatgaagatggaaggagcccaagcatctgggacacttttactcatgcagggagg
atgccagacaagagcacgggcgatctgggcgcaggcggctatcacaaatacaaggaggat
gtgaagctgatgagtgatactggcctggaggcctaccgcttctccatttcttggtccagg
cttattccaagaggaagaggacccatcaacccgaaggggctcgagtactacaacaacctg
ataaacgagctagtaaaacggggaattgagatacacgtgaccctgtaccacctggatttc
ccccagatcctggaggacgagtaccacgggtggctgagccccagggtcgtggaggacttc
gcggcgtacgcggacgcgtgcttcagggagttcggcgacagggtgaagcactggaccacc
atggatgagccgaacgtgatctccatcgccgcctacgacaacggcgccttcccgccctgc
cgctgctcgccgccgttcgggatcaactgcaccgaggggaactcctccgtggagccctac
atcgtcggccacaactccatcctggcgcacgccgccgccgtcaggctctacagagaacag
taccaggctacgcagaaaggcgtcgttggcatgaacgtctacagcatctggaactacccg
ttctcgacgagccccgcagacatggcagcaactcggagatcaatggacttcatgattggc
tggatcataaaccccttggtatatggagactatcctgaaaccatgaagaggatagttggg
tcccgtcttccgaaattcaccaaagaacagtctgagatgatccgtggaacggctgatttc
attggcataaaccactacacctcagtgtacgttagcgaccgatcgaacagcgcagatacc
gggccccgggattacaatggtgatgtggccgctaccttcagattttctcgcaatgatcca
cctactggtcagtttattccaatcaacatgcctacggatccacaggggctgcaatgcatg
ctcgagtacctcagcaacacttacaagaatgttgctgtctatgtgcaagaaaatggatat
ggggcgttcttcaatgactcaattgaggaccataagagagtagagtacttgagtggctac
attggcagcaccctcactgcactaaggaatggagccaatgtgaagggttatttcgtttgg
tcattccttgatgtatttgagctgctggcaggctactattcgcgatacggtctttatcat
gttgattttaaggatccagagctgccaaggcagccgaaactctctgcccattggtactcc
aaattcttgaagagtgagatcggaataaacatagaaagcacaaccaatactgatggaggg
tcacatgctgcacaatag

DBGET integrated database retrieval system