KEGG   Setaria italica (foxtail millet): 101765547Help
Entry
101765547         CDS       T02818                                 

Definition
(RefSeq) GPI transamidase component PIG-T
  KO
K05292  GPI-anchor transamidase subunit T
Organism
sita  Setaria italica (foxtail millet)
Pathway
sita00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
sita01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sita00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    101765547
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gpi16
Motif
Other DBs
NCBI-GeneID: 101765547
NCBI-ProteinID: XP_004965951
UniProt: K3XVS7
Position
IV
AA seq 645 aa AA seqDB search
MAPPPPPSGTVLFLYLLLLFLLSTAAAASAAAPEEEFTEELLLRPLPDRKALAHFYFRSS
APPAATVGRHHHLFPKAISQLVKKYHISELELSFTQGRWNYEQWGGFDPMSTSNAKPPGV
ELWAVFDLPSSEIDATWKNLTHTLSGLFCASINFLESSTAFSAPRWGFKLNEGNLRYGAL
PREAVCTENLTPWLKLLPCRDKAGIASLLYRPSIYKGYYHSQKLKLRSSQSLGIILDQTL
TVVLQPNTINDKQLHSNLGQLQPSWSMRHLFNRKLSGKCLVSKYSRIFIEFDKGIVDKVN
KSGSDLSWNNEFFVLSNGPDRLIKGLNNLEVQSSFIYEYDVSNYSEEKPFDVGITWKLPL
IWSCTPSPFHASRFLMGSGNERGSIALSFTSTNLQKIFGSPNDCSIKAVIFQMVPWYVKV
YYHSLEIFIDGNRKTVSDVVDKIHVTPSEDKLLPGTLEMLLRFPCSMQSATLTLDFDKGF
LHIDEYPPDANQGFDIPSALVSFPEFNSARNYPEIDPLLGSPLLENFQEDTVVKSYTEVL
LVPLTTPDFSMPYNVITFTCTVLALYFGSLLNALRRRIGEEERELTKTATRHGLIRLLLA
KLRGQKVNPTESGSLSESTGSKKLLFKVVLVAVAAVLFHYFSNNS
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgccgcctccaccttctgggacggtcctcttcctgtacctcctcctcctcttc
ctcctttcgactgccgcagcggcatcggcagcggcgcctgaggaggagttcacggaggag
ctgctcctgcggccgctccctgaccgcaaggcgctggcccacttctacttccgctcctct
gcgcccccagctgccaccgtcggccggcaccaccacctcttccccaaggccatctcccag
ctggtcaaaaaatatcacattagtgagttggagctatctttcacccagggaagatggaac
tatgagcagtggggtggatttgatcctatgtcaacaagtaatgcaaaacctcctggtgtt
gagctgtgggcagtttttgatcttccttcgtctgagattgatgcaacatggaagaacctg
acccatacactatctggcctgttttgtgcatccatcaattttttagagtcttccactgca
ttttctgctcctcgttggggatttaaattgaatgaaggcaatttgcgatatggtgcattg
cctcgtgaagcagtatgcactgagaatctgacaccttggctgaaacttcttccatgtcgt
gacaaagctgggatagcttctttgttgtatagaccttcaatttacaaaggatactaccat
tcccagaaactgaaactaagatcatcccagtcacttggtattattcttgatcaaacactg
actgttgtactgcaaccaaatactattaatgataaacagctgcattctaatctaggacaa
cttcagcccagctggtccatgagacatcttttcaacagaaagttgtcagggaaatgtctt
gtttctaaatacagcagaatattcatagagtttgataaaggcattgttgacaaagttaac
aaatctggaagtgatctttcttggaataatgaattctttgtgttgtccaatggcccggac
aggttgatcaaaggcctaaataacttggaagttcaatcttcttttatatatgaatatgat
gttagtaactacagtgaggaaaagccttttgatgtgggcataacttggaagcttcccctg
atatggtcttgcaccccctcaccttttcatgcaagcagatttcttatgggtagtggaaat
gaaagagggtcaattgctctgtcctttacgtccactaatcttcagaagatatttggcagc
ccaaatgattgttcaataaaggcagttattttccagatggttccatggtatgttaaggtc
tattatcacagcctagaaatttttatagatgggaaccggaaaactgtatcagatgtagtt
gacaagattcatgtcactccttcagaagacaagcttttgcctggtactctggagatgcta
ctaagattcccttgcagcatgcagtcggctactctgacattggattttgacaagggattc
ctgcatatagatgaatatcctcctgatgctaatcaaggatttgacattccatcagctttg
gttagctttcctgagttcaactctgctagaaattaccctgaaattgatccattacttggg
tctcctttactagaaaatttccaggaagacactgttgtgaagtcgtatacagaagtattg
ctcgttcccctgacgactcctgatttcagcatgccatacaatgttatcaccttcacctgc
actgttttagctctttattttggctcattattgaatgcattaagacgaaggatcggcgag
gaagagagggagttgacgaaaacagccacaaggcatgggctcattcgtctgttgctagct
aagctaagagggcagaaggtcaatcctacggagtcagggtctttatccgaatcgactgga
tcaaagaagctgctattcaaggttgtacttgttgcagtagctgcagttctgtttcactat
ttctcaaacaacagttga

DBGET integrated database retrieval system