KEGG   Setaria italica (foxtail millet): 101765676Help
Entry
101765676         CDS       T02818                                 

Definition
(RefSeq) heat shock cognate 70 kDa protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
sita  Setaria italica (foxtail millet)
Pathway
sita03040  Spliceosome
sita04141  Protein processing in endoplasmic reticulum
sita04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:sita00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    101765676
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101765676
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101765676
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sita01009]
    101765676
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:sita03041]
    101765676
   03009 Ribosome biogenesis [BR:sita03009]
    101765676
   03110 Chaperones and folding catalysts [BR:sita03110]
    101765676
   04131 Membrane trafficking [BR:sita04131]
    101765676
   03051 Proteasome [BR:sita03051]
    101765676
   03029 Mitochondrial biogenesis [BR:sita03029]
    101765676
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sita04147]
    101765676
Protein phosphatases and associated proteins [BR:sita01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     101765676
Spliceosome [BR:sita03041]
 Complex B
  Other components
   Prp19 complex
    101765676
 Complex C
   Prp19-CDC5 complex
    101765676
Ribosome biogenesis [BR:sita03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    101765676
Chaperones and folding catalysts [BR:sita03110]
 Heat shock proteins
  HSP70 / DNAK
   101765676
Membrane trafficking [BR:sita04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    101765676
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    101765676
Proteasome [BR:sita03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    101765676
Mitochondrial biogenesis [BR:sita03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    101765676
Exosome [BR:sita04147]
 Exosomal proteins
  Proteins found in most exosomes
   101765676
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Radial_spoke_3 Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 101765676
NCBI-ProteinID: XP_004984743
UniProt: K4A6U5
Position
IX
AA seq 650 aa AA seqDB search
MASKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGEAAKN
QVAMNPTNTVFDAKRLIGRRFSDPSVQADMKMWPFKVVPGPADKPMIVVTYKGEEKKFSA
EEISSMVLTKMKEIAEAYLSTTIKNAVITVPAYFNDSQRQATKDAGVIAGLNVTRIINEP
TAAAIAYGLDKKAASTGEKNVLIFDLGGGTFDVSILTIEEGIFEVKATAGDTHLGGEDFD
NRLVNHFVQEFKRKHKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFY
ATITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSQIHDVVLVGGSTRIPKVQQLLQDFF
NGKELCKSINPDEAVAYGAAVQAAILSGEGNQKVQDLLLLDVTPLSLGLETAGGVMTVLI
PRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTKDNNLLGKFELTGIPPAPRGVPQI
NVTFDIDANGILNVSAEDKTTGKKNKITITNDKGRLSKEEIERMVQEAEKYKAEDEEVKR
KVEARNALENYAYNMRNTVRDDKIASKLPAEDRKKIEDTIEDAIKWLDGNQLAEAEEFED
KMKELEGICNPIISKMYQGEGGAAGMDEDVPNGAGTGGGSGAGPKIEEVD
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcaagggggagggcccggcgatcggcatcgacctcggcaccacctactcgtgc
gtcggggtgtggcagcatgaccgggtggagatcatcgccaacgaccagggcaaccgcacc
acgccctcgtacgtggcgttcaccgacaccgagaggctcatcggcgaggccgccaagaac
caggtcgccatgaaccccaccaacaccgtctttgacgccaagcggctcatcggcaggcgc
ttctcggacccgtccgtgcaggcggacatgaagatgtggccgttcaaggtcgtccccggc
ccggccgacaagcccatgatcgtggtgacctacaagggcgaggagaagaagttctcggcg
gaggagatctcctccatggtgctcaccaagatgaaggagatcgccgaggcatacctcagc
accaccatcaagaacgccgtcatcaccgtgccggcctacttcaacgactcccagcgccaa
gccaccaaggacgccggcgtcatcgcgggcctcaacgtcacgcgcatcatcaacgagcct
accgccgccgccatcgcctacgggctcgacaagaaggccgccagcaccggcgagaagaac
gtcctcatcttcgacctcggcggcggcaccttcgatgtgtccatcctcaccatcgaggag
ggcatcttcgaggtcaaggccaccgccggtgacacccacctgggcggcgaggacttcgac
aaccggctcgtgaaccacttcgtgcaggagttcaagaggaagcacaagaaggacatcagc
ggcaacccgagggcgctccggcggctgaggacggcctgcgagagggccaagaggacgctc
tcctccaccgcccagaccaccattgagatcgactcgctctatgagggcatcgacttctat
gcgaccatcactcgggcaaggttcgaggagctcaacatggacctcttcaggaagtgcatg
gagcccgtggagaagtgcctccgcgacgccaagatggacaagtcgcagatccacgacgtc
gtgctcgtcggaggctccacccgtatccccaaggtgcagcagctactccaggacttcttc
aacggaaaggagctctgcaagagcatcaaccccgacgaggccgtcgcgtacggcgcagct
gtccaggctgccatcctcagcggcgagggcaaccagaaagtgcaggacctgctcctgctc
gacgtcacgccgctctcactcgggctggagacggccggtggcgtcatgactgtgctgatc
ccgaggaacaccaccattccgaccaagaaggagcaggtcttctccacctactccgacaac
cagcccggcgtgctcatccaggtgtacgagggtgagaggacgaggaccaaggacaacaac
ctgctcggcaagttcgagctgaccggcatccctccggctcccaggggcgtgccccagatc
aacgtgaccttcgacatcgacgcgaacggcatcctgaacgtgtcggcggaggacaagacg
acgggtaagaagaacaagatcaccataaccaacgacaagggccggctgagcaaggaggag
atcgagcgcatggtgcaggaggccgagaagtacaaggccgaggacgaggaggtgaagcgc
aaggtggaggcccgcaacgcgctggagaactacgcgtacaacatgcgcaacacggtgcgg
gacgacaagatcgcgtcgaagctgcccgcggaggacaggaagaagatcgaggacacgatc
gaggacgccatcaagtggctcgacggcaaccagctcgccgaggccgaggagttcgaggac
aagatgaaggagctggaggggatctgcaaccccatcatctccaagatgtaccagggcgag
ggcggcgccgcgggcatggacgaggacgtgcccaacggcgccggcaccggcggtggaagc
ggcgccgggccaaagattgaggaggtggactaa

DBGET integrated database retrieval system