KEGG   Setaria italica (foxtail millet): 101766978Help
Entry
101766978         CDS       T02818                                 

Definition
(RefSeq) 9-cis-epoxycarotenoid dioxygenase NCED4, chloroplastic
  KO
K09840  9-cis-epoxycarotenoid dioxygenase [EC:1.13.11.51]
Organism
sita  Setaria italica (foxtail millet)
Pathway
sita00906  Carotenoid biosynthesis
sita01100  Metabolic pathways
sita01110  Biosynthesis of secondary metabolites
Module
sita_M00372  Abscisic acid biosynthesis, beta-carotene => abscisic acid
Brite
KEGG Orthology (KO) [BR:sita00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    101766978
Enzymes [BR:sita01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.51  9-cis-epoxycarotenoid dioxygenase
     101766978
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPE65
Motif
Other DBs
NCBI-GeneID: 101766978
NCBI-ProteinID: XP_004955480
UniProt: K3ZRT6
Position
II
AA seq 582 aa AA seqDB search
MASSVTAPPAAAPATAPAKPKKPSQLKPSTGTGKASRTAAPVRPMRAATPAGPKWNPFQR
LAAAALDAVEDGLVAGLLERAHPLPRTADPAVQIAGNYAPVGERPPRRRGEAAPRPLPVS
GRVPPCLDGVYVRNGANPLHEPRAGHHLFDGDGMLHAVRLRAGRAESYACRFTETARLRQ
ERAIGRAVFPKAIGELHGHSGVARLLLFGARSLCGVLDASQGIGVANAGLVFHNNRLLAM
SEDDLPYHVRVTADGDLETVGRYDFGGQLEGAMIAHPKLDPATGELFALSYNVVSKPYLK
YFYFTADGRKSPDVEIPVDAPTMMHDFAVTENYAIIPDQQIVFKLQEMVLGGSPVVYDKT
KTSRFGVLPKRAADASELRWVEVPDCFCFHLWNAWEDDATGEIVVIGSCMTPADAVFNES
GEGEAFQSVLSEIRLDPTTGTSRRRAVLAADDQVNLEAGMVNRQLLGRKTRYVYLAIAEP
WPKVSGFAKVDLETGTAEKFIYGEGRYGGEPCFVPRPGAGAGAEEDDGYVLCYVHDEARG
ASEMLVVNARDMREEAAVKLPGRVPYGLHGTFISGEDLQRQA
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgtccgtcaccgctcccccggcggcggctccggccaccgcgccggcgaagccc
aagaagccgtcgcagctcaaaccgagcaccgggaccggcaaggcctcccgcaccgcggcc
cccgtgcggccaatgcgcgccgccaccccggccggccccaagtggaacccgttccagcgg
ctcgcggcggcggcgctggacgccgtcgaggacggcctcgtcgcgggcctcctcgagcgc
gcgcacccgctcccccgcaccgccgaccccgccgtccagatcgccggcaactacgcgccc
gtcggggagcgcccgccccgccgccgcggcgaggcggcgccgcgcccgctccccgtctcc
ggccgcgtcccgccctgcctcgacggggtctacgtccgcaacggcgcgaacccgctccac
gagccccgcgcggggcaccacctcttcgacggcgacgggatgctccacgccgtgcgcctc
cgcgccgggcgcgccgagtcctacgcgtgccggttcacggagacggcgcggctccggcag
gagcgcgccatcggccgcgcggtatttccaaaggccatcggcgagctccacggccactcc
ggcgtcgcccgcctcctcctcttcggcgcccgctccctctgcggcgtcctcgacgcgtcc
caggggatcggggttgccaacgccggcctcgtgttccataacaaccgcctcctcgccatg
tccgaggacgacctcccgtaccacgtccgcgtcaccgccgacggcgacctcgagaccgtc
ggtcgctacgacttcggcggccagctcgaaggcgccatgatcgcgcaccccaagctcgac
ccggccaccggcgagctcttcgcgctcagctacaatgtcgtctccaagccgtacctcaag
tacttctacttcaccgctgacggccgcaagtcccccgacgtcgagatccccgtcgacgcg
cccaccatgatgcacgacttcgccgtcaccgagaactacgccatcatccccgaccagcag
atcgtcttcaagctccaggagatggttctcggaggctcccccgtcgtgtacgacaagacc
aagacctcgcggttcggggtgctcccgaagcgcgccgccgacgcgtcggagctccggtgg
gtggaggtccccgactgcttctgcttccacctctggaacgcgtgggaggacgacgctacc
ggcgagatcgtcgtgatcgggtcctgcatgaccccggccgacgccgtcttcaacgagtcc
ggcgagggggaggccttccagagcgtgctgtcggagattcgcctcgaccccaccaccggc
acgtcgcggcggcgcgctgtgctggccgccgacgaccaggtgaacctcgaggccgggatg
gtgaaccggcagctgctgggccgcaagacccggtacgtctatctcgccatcgccgagccg
tggcccaaggtgtcggggttcgccaaggtggacctggagaccggcaccgccgagaagttc
atctacggcgagggccggtacggcggcgagccctgcttcgtgccgcgcccgggcgccggc
gccggcgcggaggaggacgacggctacgtgctttgctacgtccacgacgaggcccgcggc
gcgtcggagatgctcgtcgtcaacgcccgcgacatgcgggaggaggccgccgtcaagctg
ccgggccgcgtcccgtacgggctgcacggcaccttcatctccggcgaggacctgcagcgg
caggcctag

DBGET integrated database retrieval system