KEGG   Setaria italica (foxtail millet): 101767877Help
Entry
101767877         CDS       T02818                                 

Definition
(RefSeq) probable glutathione S-transferase GSTF1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
sita  Setaria italica (foxtail millet)
Pathway
sita00480  Glutathione metabolism
sita01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sita00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    101767877
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sita02000]
    101767877
Enzymes [BR:sita01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     101767877
Transporters [BR:sita02000]
 Other transporters
  Pores ion channels [TC:1]
   101767877
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_C GST_N_3 GST_C_3 GST_C_2 GST_N_2
Motif
Other DBs
NCBI-GeneID: 101767877
NCBI-ProteinID: XP_004968765
UniProt: K3XLU1
Position
V
AA seq 218 aa AA seqDB search
MAPVKVFGPAMSTNVARVLVCLEEVGAEYEVVNIDFQAKEHKGPEHLARNPFGQIPAFQD
GDVVLFESRAISKYILRKYKSAETDLLREGNLREAAMVDVWTEVEAHQYNPALSPVVYEC
LINPTMRGVPTNQKVVDESLEKLRKVLHVYEARLSKSKYLAGDFLSFADLNHFPYTFYFM
ATPHASLFDSYPHVKAWWERLMARPSMKKLGASMAPKP
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggcgccggtgaaggtgttcggaccggcgatgtcgacgaacgtggcgcgggtgctggtg
tgcctggaggaggtgggcgccgagtacgaggtcgtcaacatcgacttccaggccaaggag
cacaagggccccgagcacctcgccaggaacccattcggccaaatccccgcgttccaggac
ggtgacgtcgtgctcttcgagtcccgagcaatctccaagtacattctccgcaagtacaaa
tcagctgagaccgacctcctgcgagaaggcaacctcagggaagcggccatggtggacgtg
tggacggaggtggaggcgcaccagtacaacccggcgctctcgcccgtcgtgtacgagtgc
ctcatcaacccgaccatgcgaggcgtccccaccaaccagaaggtggtggacgagagcctg
gagaagctccggaaggtgctccatgtctacgaggcgcgcctgtccaagagcaagtacctc
gccggggacttcctcagcttcgcggacctcaaccacttcccctacaccttctacttcatg
gccacgccgcacgcatcgctcttcgactcgtacccgcacgtcaaggcctggtgggagagg
ctcatggcgaggccgtctatgaagaagctcggcgccagcatggccccgaagccttga

DBGET integrated database retrieval system