KEGG   Setaria italica (foxtail millet): 101770354Help
Entry
101770354         CDS       T02818                                 

Definition
(RefSeq) tyrosine decarboxylase 1
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
sita  Setaria italica (foxtail millet)
Pathway
sita00350  Tyrosine metabolism
sita00360  Phenylalanine metabolism
sita00380  Tryptophan metabolism
sita00950  Isoquinoline alkaloid biosynthesis
sita00965  Betalain biosynthesis
sita01100  Metabolic pathways
sita01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sita00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    101770354
   00360 Phenylalanine metabolism
    101770354
   00380 Tryptophan metabolism
    101770354
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    101770354
   00950 Isoquinoline alkaloid biosynthesis
    101770354
   00965 Betalain biosynthesis
    101770354
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sita04147]
    101770354
Enzymes [BR:sita01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     101770354
    4.1.1.105  L-tryptophan decarboxylase
     101770354
Exosome [BR:sita04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101770354
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase SepSecS Aminotran_5 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 101770354
NCBI-ProteinID: XP_004956078
UniProt: A0A368PXK1
Position
II
AA seq 500 aa AA seqDB search
MDGSGSSNEGANGGGEWLRPMDAEQLRECGHRMVDFVADYYKSIETFPVLSQVQPGYLKE
LLPDTAPSKPDTLEALFDDIREKIVPGVTHWQSPNYFAYYPSNSSTAGFLGEMLSAAFNI
VGFSWITSPAATELEVIVLDWFAKMLNLPSQFLSSALGGGVIQGTASEAVLVVLLAARDR
TLRKHGKTSLEKLVVYASDQTHSSLQKACQIAGIFPENVRVVKADCNKNYAVAPEAIFEA
ISTDLSSVLIPFFICATVGTTSSSAVDPLPELGQIAKAHDMWLHVDAAYAGSACICPEYR
HHLNGIEEADSFNMNAHKWFLTNFDCSLLWVKDRSYLIQSLSTNPEYLKNKASQANSVLD
FKDWQIPLGRRFRSLKLWMVLRLYGVENLQSYIRKHIGLAKYFEELVISDSRFEVVTPRT
FSLVCFRLLPLASDQDNGYKLNYGLMDAANSSGKIFISHTVLSGKFILRFVVGAPLTEEQ
HVFAAWKVLQDLATKQLGSS
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggacgggagcgggagcagcaatgaaggagccaacggcggcggcgagtggctgcggccg
atggacgcggagcagctgcgggagtgcggccaccggatggtggatttcgtcgccgattac
tacaaatccatcgagaccttccccgtcctcagccaagtccagccaggatatctgaaggaa
cttctaccagatactgctccaagcaaacctgatacgttggaggccctttttgatgatata
cgagagaagatagtgccaggagttacacattggcaaagtccaaactacttcgcctattat
ccttccaatagtagcactgctggcttccttggagagatgctgagtgcagcttttaacatt
gtcggattcagttggataacctctcctgctgcaactgagctagaggttattgtcttggat
tggtttgcaaaaatgcttaacctgccaagtcagttcctgtcaagtgcacttggtggaggt
gtaatccagggtactgccagtgaagcagttcttgttgtactcttggctgcacgggacaga
actttaaggaagcatgggaagacatctcttgaaaaactagtagtttatgcatcagatcag
acacattcttctctgcagaaggcatgccagattgctgggattttcccagagaatgtgaga
gtggtgaaggctgactgcaataaaaattatgctgttgcacctgaagccatttttgaggcc
atttccacagacttgtcatctgtcttgataccatttttcatctgcgcaacagttggcaca
acatcttcatcagctgtggaccccttgcctgagctaggacaaatagccaaggcccacgac
atgtggctccatgttgatgctgcctatgcaggaagtgcctgcatatgccccgaataccga
catcacttgaatggaattgaagaagcggattcatttaatatgaatgcacataaatggttt
ctgactaactttgattgttccttgctatgggtgaaggacagaagttatcttatacaatca
ttgtctacgaatccagagtatctcaagaataaggcgtcccaagcaaattctgttcttgat
ttcaaagactggcaaattccgcttggacgccgttttagatcacttaagttatggatggtc
ttgaggctttatggcgtggaaaacctgcaaagctatattagaaagcatatagggttagcc
aaatattttgaagaacttgtgatctctgattcaagattcgaggtagtgactccaaggacc
ttttcgcttgtttgtttccgccttctgcccctggcctctgaccaagacaatggttacaaa
ctaaactatggcctaatggatgctgctaactcaagcgggaagatcttcatatctcatacg
gtcctttctggcaagttcatcttgagatttgtagtaggagcgccactcacagaggagcaa
cacgtctttgctgcttggaaggttctgcaagatttggccactaaacagttaggaagttca
tag

DBGET integrated database retrieval system