KEGG   Setaria italica (foxtail millet): 101770598
Entry
101770598         CDS       T02818                                 

Definition
(RefSeq) uncharacterized protein LOC101770598
Organism
sita  Setaria italica (foxtail millet)
SSDB
Motif
Pfam: TraB
Other DBs
NCBI-GeneID: 101770598
NCBI-ProteinID: XP_004973356
UniProt: K3YHP8
Position
VI
AA seq 437 aa
MLSTAAAPSTSIAAALPSSRARRRRSRGVLVAVAAGAGEGGAERFATSSSITDYLRYRRP
DGGGAGGRGGVAGGELQTAVVRFEKRFPWSLLHPFLHVDLVSTVHIADKEYFDRLQQELG
RYDCVLYEMVMSRDNLNNPKGPMAAKKMKSSRRGFSILGFIQKQMARILSLDYQLDCLDY
GNEKWQHADLDYETFKQLQSERGESILTFAVDMTLKSTKALVQPTNMPDGLDFWRSKLLW
ASRVLPMPLVGLLVITGLCLPVENQDGFPELEALSKLDFGAALKIFLAKQLTSEFTAVTS
PVEEKSVIIGERNRVATEKIKEAINRGYKRIAVLYGGGHMPDLGRRLGEELDMVPADVQW
VTAWSIRSRELESKSLPFLKTLAEASGWPLNRYETLALLIFSSVLAVDLWFWELFFGTAV
NWASLAGSWIDQLDGSF
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgctctcgacggcggcggcgccctcgacctccatcgccgccgcgctcccctcctcccgc
gcgcgccgccggcgctcccgcggcgtcctcgtcgccgtcgcggcgggggcgggggaggga
ggtgcggagcggttcgccaccagcagctccatcaccgattacctccggtaccgccgcccc
gacggcggtggtgccggaggaaggggaggagtcgccggcggggagctgcagacggcggtg
gtccgcttcgagaagcgcttcccgtggtcgctcctccaccccttcctgcacgttgatttg
gtttctacagtccacattgccgataaagaatactttgataggctgcagcaagagcttgga
cgttatgattgtgtcctgtatgaaatggttatgagtcgggataatttgaacaatccgaaa
ggtccaatggctgctaagaagatgaaatcttcacgtagaggattcagtattcttggcttc
atacagaagcaaatggctcggatcctttcattggattatcagttagactgtcttgattat
ggcaatgagaaatggcaacatgctgaccttgactatgaaacattcaagcagcttcagagc
gaaagaggtgaaagtatcctcacatttgcagtagacatgacactgaaatcaaccaaagcc
ttggtgcaaccaactaacatgccagatggtcttgacttttggagatcaaagttactctgg
gcctcacgtgtgctaccaatgccacttgttggactactcgtcatcactgggctttgtttg
ccagtagagaaccaagatggatttcctgagctggaggcattgtctaagctagattttgga
gctgcactgaagattttcttggcaaagcaactgacatctgaattcacagctgtgacatct
cctgttgaggaaaagtcagttatcattggggagaggaacagagttgccactgagaagata
aaggaagcaataaaccgcgggtacaagagaatagcagttctttatggtggtggacatatg
ccagacctgggaagacgccttggagaagagctcgatatggtcccagctgatgtgcagtgg
gttacagcatggtcaataaggagccgagagctagaaagcaaatccctcccattcttgaag
acactggcagaggcttcaggctggcctttgaatagatatgagacacttgctctgctcatc
ttttcttcagtgcttgcggtggatctttggttctgggagctcttctttggtactgctgtg
aactgggcatcactggctggttcctggattgaccagcttgatggttcattttga

DBGET integrated database retrieval system