KEGG   Setaria italica (foxtail millet): 101770641Help
Entry
101770641         CDS       T02818                                 

Definition
(RefSeq) probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH4
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
sita  Setaria italica (foxtail millet)
Pathway
sita03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:sita00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    101770641
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:sita03041]
    101770641
Enzymes [BR:sita01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     101770641
Spliceosome [BR:sita03041]
 Complex C
  Other components
   Step II factors
    101770641
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C AAA_22 DEAD AAA_30 AAA_19 DUF2075 cobW ABC_tran AAA_16 Helicase_RecD T2SSE AAA_33 ATPase_2 Flavi_DEAD AAA_14 AAA_29
Motif
Other DBs
NCBI-GeneID: 101770641
NCBI-ProteinID: XP_004979200
UniProt: K3ZHI8
Position
VIII
AA seq 701 aa AA seqDB search
MPSPSPPVLPISEHEDEIVAAVDTNPVVVVIGETGSGKSTQLSQILHRRGYTRRGAIAVT
QPRRVAAVSVSRRVAQELGVPLGDEVGYAIRFEDRTSERTCIKYLTDGVLLRESLSNPDL
KQYSVIILDEAHERSLNTDILLGLMKRLVKDRASDLKVLITSATLDGLKVSKFFSGCPVL
NIPGTLFPVEKFYSTERPTNYIESSLRTAIDIHAKEPPGDVLIFMTGKDDIDKMVSKLEE
RIQNLEEGSCMDALVLPLHGSLPPELQVRVFAPAPPNCRRFIVATNVAETSLTVDGVVFV
IDCGYVKQRQYNPSSGMYSLDVVQISRVQADQRAGRAGRTRPGKCYRLYPMSIYQKEFLE
ATVPEIQRSSLAGSVLYLKSLNLPDINILKFDFLDPPSRESLEDALRQLYLIDAIDENGQ
ITDVGRIMAELPLEPSLSRTLIEANELGCLSQALTVAAILSAEITLRSTRSKDMEGKRKR
QELPDGSGWGDHIQLLQIFESWDQTGYDPRWCSDHDLQVRGMKLSKDVRNQLCQIIQKIA
KGPTDVHARKSRKSDPDYRKLRRALCVGYGNQLAERMLHHNGYHTVGYRTQLVQVHPSSV
LEGDEYGKFPMYVVYHELISTTRPYMRNICAVDQAWVEPILKKLEKLDINRLSGGSALKD
SEPLEDKQVNMPKKAVDVKQSEVDSKIQAARERYLARKGKK
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcgccgtcaccgccggtgctgccgatctcggagcacgaggacgagattgtcgcc
gcggtggacacgaacccggtggtggtggttatcggcgagaccggctctggcaagagcacc
cagctctcccagatcctccaccgccgcggatacacccgccggggcgccatcgccgtcacc
caaccccgccgcgtcgccgccgtctccgtctccagaagagtagctcaggagcttggtgtc
ccactcggggatgaagtgggttatgcaattcgatttgaggacagaacttcagagagaaca
tgcataaaatacctcacggatggcgttcttcttcgtgaaagcctttcaaatcctgatttg
aagcaatactcagtaatcatactggacgaagctcatgagcgtagtctaaacactgatatc
cttttaggtttgatgaaaagattggtcaaggaccgagcttcagatttaaaagttctgatc
acctctgcgactcttgatggtttgaaagtttcaaagttcttctcaggatgccctgtgtta
aacattcctggaactttattccctgtggagaaattttacagcactgagcgcccaacaaat
tatatagaatcttcactcaggacagctatagatatccatgccaaggaaccccctggggat
gtcttaatatttatgacaggaaaggatgatattgacaagatggtctcaaaattggaggag
agaattcaaaatcttgaggaaggctcctgtatggatgctcttgtccttcctcttcatggt
tctttgccacctgaactgcaggttagggtatttgctccagcacctccgaactgtcgacgc
ttcattgttgcaacaaatgttgctgaaacttctctgactgtagatggagtcgtgtttgtg
attgattgtggctatgtaaagcaacgtcaatataatccatcaagtggaatgtattctctt
gatgtagttcagatcagcagagtgcaggctgatcagcgagcagggcgagctggaagaact
cgacccggcaagtgctataggctatacccaatgtctatatatcaaaaggagtttcttgag
gctacagttcctgaaattcaacgctcttctcttgctggaagtgttttatatctgaaatca
ttaaatcttccagacattaatatcctgaagtttgattttctagatccaccatcacgtgag
tcattagaagatgctttgaggcaattataccttattgatgcaattgatgaaaatggacaa
ataacagatgttggacgcattatggcagaactccccctggaaccttctctttcaaggact
ttgattgaagcgaatgaattgggatgtctgtctcaggcattaactgttgctgcgattttg
tcagcggaaataacattgcgatcaactagaagcaaggacatggagggaaagaggaaaagg
caagagcttccggatggttctggctggggtgaccatatacaattgcttcagatattcgaa
agctgggaccaaacaggatatgatccacgatggtgctctgatcatgatttgcaggtgcgg
ggtatgaaattgagcaaagatgtgaggaaccaactatgtcaaattattcaaaaaatcgca
aaaggtccaactgatgtgcatgcaaggaaaagccggaagagtgaccccgactatagaaag
ttaaggagagctctatgtgtaggatatggtaaccagctagctgagaggatgctgcatcac
aatgggtaccatactgttggctataggacccaacttgtacaggtgcacccatcttctgta
ctggaaggtgatgagtacgggaagtttcctatgtatgttgtttatcatgagctgataagt
acaactcgtccgtacatgagaaacatttgtgctgtcgatcaggcctgggtcgagcctata
ttgaagaagcttgagaaattagatataaacagattaagtggtgggagtgcactgaaagat
tctgaaccattggaggataagcaagtaaacatgccaaagaaagccgtggatgttaaacaa
tctgaggtggacagtaaaatccaggcagctcgtgagcgctaccttgcacggaaaggcaag
aaatga

DBGET integrated database retrieval system