KEGG   Setaria italica (foxtail millet): 101772577Help
Entry
101772577         CDS       T02818                                 

Definition
(RefSeq) protein ABSCISIC ACID-INSENSITIVE 5
  KO
K14432  ABA responsive element binding factor
Organism
sita  Setaria italica (foxtail millet)
Pathway
sita04075  Plant hormone signal transduction
Brite
KEGG Orthology (KO) [BR:sita00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04075 Plant hormone signal transduction
    101772577
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sita03000]
    101772577
Transcription factors [BR:sita03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AREB/ABF
    101772577
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf
Motif
Other DBs
NCBI-GeneID: 101772577
NCBI-ProteinID: NP_001296980
UniProt: K3XIK9
Position
V
AA seq 399 aa AA seqDB search
MASEMSKNVKVLDEQEVTSHQRDQGLRARISGVAAEDQADPLARQASIMSLTLEELQNSL
CEPGRNFGSMNMDEFMANIWNAEEFQAATGGCKEDAEQEAAAAAAAVPTAAVEKGGGSGG
LVRQGSYALPPPLSRKTVEEVWAEINQAPGDAQAHPAPQAIVQPQMGSGGLAASGRQVTL
GEMTLEDFLVKAGVVRGAFAGGHGQAVGMVPAGPMGHMQQQGQLAATPMMYQVAPANAAA
VYPVMGDGMGYHNGYAGGMAVVPPPPPSQCVAPAVSPGSSDGMSAMTQAEMMSCIGNGGM
VRNGGSNARKRDSPEDGCTEKTVERRQRRMIKNRESAARSRARKQAYTVELEAELNHLKE
ENARLKAEELVEKMMEQARENINAKKGGRGLRRCGSAMW
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcggagatgagcaagaacgtcaaggtcctcgacgagcaggaggtcacctcgcac
cagcgcgaccagggcctccgggcccggatcagcggcgtggcggcggaggatcaggcggat
ccgttggcgcggcaggcgtcgatcatgtcgctgacgctggaggagctgcagaactcgctc
tgcgagcccggccgcaacttcgggtccatgaacatggacgaattcatggccaacatatgg
aacgccgaggagttccaggccgccaccggcggatgcaaggaggacgcggagcaggaggcg
gcggcggcggcggcggcggtgccgacggcggctgttgagaagggaggagggagcggcgga
ttggttcggcaggggtcgtacgcgctgccaccgccgctgtcccggaagacggtggaggag
gtttgggccgagatcaaccaggccccgggcgacgcgcaggcccaccccgcgccgcaggcc
atcgtgcagccgcagatggggagcggcggcctcgcggccagcgggcggcaggtgacgctg
ggggagatgacgctggaggacttcctggtcaaggccggcgtcgtgcgaggggccttcgct
ggcgggcacgggcaggcagtcggcatggtcccggccgggccgatgggccacatgcagcag
caggggcagctcgcagcgactcccatgatgtaccaggtggcgccggccaacgccgccgcc
gtgtatccggtgatgggcgacggcatggggtaccacaacgggtatgccgggggcatggcg
gtggtgccgccgccgccgccgtcccagtgcgtggcgcccgccgtcagcccggggtcgtcg
gacgggatgagcgcgatgacgcaggcggagatgatgagctgcattggcaacggagggatg
gtccggaacggcggcagcaacgcccggaagcgcgactcccccgaggacgggtgcaccgag
aagacggtggagcgccggcagcggcgcatgatcaagaaccgcgagtcggcggcccggtca
cgcgccaggaagcaggcatataccgtggagctcgaggccgaactgaaccatctcaaggag
gagaatgcacgcctcaaagccgaggagctggtggagaagatgatggagcaggcacgggag
aacatcaacgccaagaagggcggtcgcggccttcgccgctgcggcagcgccatgtggtga

DBGET integrated database retrieval system