KEGG   Setaria italica (foxtail millet): 101772807Help
Entry
101772807         CDS       T02818                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
sita  Setaria italica (foxtail millet)
Pathway
sita00010  Glycolysis / Gluconeogenesis
sita00562  Inositol phosphate metabolism
sita01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sita00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101772807
   00562 Inositol phosphate metabolism
    101772807
Enzymes [BR:sita01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     101772807
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     101772807
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 101772807
NCBI-ProteinID: XP_004981272
UniProt: K4A8I4
Position
IX
AA seq 520 aa AA seqDB search
MATPRAPLFPQLLLLVAAALLAAASLRRAAGAGEFDVRRHLSTVTRYDVARGSNSVNSMP
TIPDGCRVIHLNLVARHGTRAPTKKRIKELDRLSIRLEALINEAKQGLKSDSLKKIPSWI
KGWESRWKGRTKGGELTSEGEEELYNLATRVKERFQDLFDDEYHPDVYSIRATQVSRASA
SAVAFGLGLLSGKGKLGPGNNRAFSVLSESRASDICLRFFDSCETYKAYRKRKEPDVKKQ
KEPVLEHVTAALVNRYHLNFTTQDVSSLWFLCKQEASLLNITNQACGLFNEAEVYFLEWT
DDLEGFVLKGYGESINYRMGLPLLKDVVQSMEEAIIAKEEHHPDGTYEKARLRFAHAETV
VPFSCLLGLFLEGSDFEKIQREEALDLPPMPPQGRNWKGSVVAPFAGNNMLVLYQCPGKT
SDGSTFGSQNNSYVIQVLHNEIPVLMPGCGNKDFCPFEEFKEKIVKPHLKHDYDMICKIK
PPVAGEEPATFSSKVSGFFTGLLSQKGYRVASAESVKTEL
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atggccactccgcgcgcgccgctcttcccccagctgctgctcctcgtcgccgcggcgctc
ctcgcggccgcttccctccggagggcggcaggggccggcgagttcgacgtccgccgccac
ctctccaccgtcaccaggtatgatgtggccagaggctccaatagtgtcaattctatgccg
acaatcccagatgggtgccgtgtgatccacctcaatctagtggcaagacatgggactcgt
gctcctaccaagaagcgaatcaaggagcttgatagattgtcaatcaggctggaagctctt
ataaatgaggcaaaacaaggtctcaagagtgattctctcaagaaaattccatcctggata
aagggctgggagtcgcgttggaagggtaggactaaaggtggtgagctgactagtgaagga
gaagaagagctttacaacttagcgaccagagtgaaggagaggtttcaagacctttttgat
gacgaatatcacccagatgtatattcaataagagcaactcaggtttctcgagcatcagct
agtgcggtagcatttggtttgggactgctttctgggaaaggaaagcttggaccagggaac
aaccgtgccttttctgttctgagcgagagtcgtgcaagtgatatttgtctgagattcttt
gacagctgtgagacatacaaggcatacaggaaaaggaaggagcctgatgtcaagaagcaa
aaggagccggttctagagcatgtcacagctgcacttgtcaatcgttatcacctcaatttt
acaactcaggatgtctcctctctctggtttctttgcaagcaggaagcatctttattgaat
ataaccaatcaagcttgtgggctttttaatgaagctgaggtttattttctagagtggaca
gatgatttggagggttttgttctaaaaggctatggtgagtcaattaactaccggatggga
ctgccattgctcaaggatgttgtccagtcaatggaagaagcaatcatagctaaagaagaa
caccaccctgatggtacgtatgaaaaggcaaggctccgatttgcacacgcagaaactgtt
gttcctttcagctgccttcttggtctttttcttgaaggctcagattttgagaagatacag
cgggaggaagcattggatctgccacctatgccaccacagggaagaaactggaagggcagt
gttgtagccccctttgctggtaacaatatgctggttttgtaccagtgcccaggcaaaaca
tcggatggcagcacttttgggagtcaaaataactcatatgtcattcaagttctacacaac
gaaatcccagttttgatgccgggttgcggtaacaaagatttctgcccatttgaggagttc
aaggagaagatagtgaaaccgcacctgaagcatgactatgacatgatatgcaagatcaag
ccgcccgtggcaggagaggagcccgccacgttcagctccaaggtgtccggtttcttcaca
ggattgctctcgcagaagggatacagggtcgctagcgctgagagcgtcaagacagagttg
tag

DBGET integrated database retrieval system