KEGG   Setaria italica (foxtail millet): 101774400Help
Entry
101774400         CDS       T02818                                 

Definition
(RefSeq) thiamine thiazole synthase 2, chloroplastic
  KO
K03146  cysteine-dependent adenosine diphosphate thiazole synthase [EC:2.4.2.60]
Organism
sita  Setaria italica (foxtail millet)
Pathway
sita00730  Thiamine metabolism
sita01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sita00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    101774400
Enzymes [BR:sita01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.60  cysteine-dependent adenosine diphosphate thiazole synthase
     101774400
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thi4 DAO FAD_binding_2 NAD_binding_8 Pyr_redox_2 GMC_oxred_N FAD_oxidored Lycopene_cycl GIDA HI0933_like NAD_binding_9 FAD_binding_3 Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 101774400
NCBI-ProteinID: XP_004957903
UniProt: K3ZUR5
Position
II
AA seq 350 aa AA seqDB search
MATAASTLHKSSFGGARLPSAPRAPSSAAAVATPRAAGVPIRASISNPPYDLTSFKFSPI
KESIVSREMTRRYMTDMITHADTDVVVVGAGSAGLSCAYELSKDPSVSVAIVEQSVSPGG
GAWLGGQLFSAMVVRKPAHLFLDELGVAYDEAEDYVVVSHAALFTSTVMSRLLARPNVKL
FNAVAAEDLIVKQGRVAGVVTNWALVAMNHGTQSCMDPNVMEAKVVVSSCGHDGPFGATG
VKRLQDIGMISAVPGMKALDMNTAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFG
AMMISGQKAAHLALKALGRPNAIDGTTQTASQAWREELVMASKDDEVVDA
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgccgcgtcgaccctccacaagtcctccttcggcggcgcccggctcccgtcg
gcgccgcgcgccccgtcctccgccgccgccgtggccacccctcgcgccgccggcgtgccc
atccgcgcctccatctccaacccgccctacgacctcacgtccttcaagttcagccccatc
aaggagtccatcgtctcccgcgagatgacccggcgctacatgacggacatgatcacccac
gccgacaccgacgtcgtcgtcgtgggcgccggctccgcgggcctctcctgcgcgtacgag
ctctccaaggacccctccgtcagcgtcgctatcgtggagcagtccgtgtcccccggcggc
ggcgcctggctgggcgggcagctgttctcggccatggtggtgcgcaagcccgcccacctg
ttcctcgacgagctcggcgtcgcgtacgacgaggccgaggactacgtggtggtcagtcac
gccgcgctcttcacctccaccgtcatgagccgcctcctggcgcggcccaacgtgaagctc
ttcaacgccgtcgccgccgaggacctcatcgtcaagcagggccgcgtcgccggggtggtc
accaactgggcgctcgtcgccatgaaccacggcacccagtcgtgcatggaccccaacgtg
atggaggccaaggtggtggtcagctcctgcggccacgacgggccgttcggggccaccggc
gtcaagaggctccaggacatcggcatgatcagcgccgtgcccgggatgaaggccctcgac
atgaacaccgccgaggacgccatcgtccgcctcacgcgcgaggtcgtgcccggcatgatc
gtcaccggcatggaggtcgccgagatcgacggcgccccgagaatgggcccgacgttcggc
gccatgatgatctccgggcagaaggcggcgcacctggcgctgaaggcgcttggaaggccc
aacgccatcgacgggaccacccagacggcgtcgcaggcgtggcgcgaggagctcgtgatg
gcgtccaaggacgacgaggtcgtggacgcgtga

DBGET integrated database retrieval system