KEGG   Setaria italica (foxtail millet): 101775420Help
Entry
101775420         CDS       T02818                                 

Definition
(RefSeq) delta-1-pyrroline-5-carboxylate synthase 2
  KO
K12657  delta-1-pyrroline-5-carboxylate synthetase [EC:2.7.2.11 1.2.1.41]
Organism
sita  Setaria italica (foxtail millet)
Pathway
sita00330  Arginine and proline metabolism
sita01100  Metabolic pathways
sita01110  Biosynthesis of secondary metabolites
sita01230  Biosynthesis of amino acids
Module
sita_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:sita00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    101775420
Enzymes [BR:sita01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.41  glutamate-5-semialdehyde dehydrogenase
     101775420
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     101775420
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AA_kinase Aldedh
Motif
Other DBs
NCBI-GeneID: 101775420
NCBI-ProteinID: XP_004970573
Position
V
AA seq 727 aa AA seqDB search
MGRGGIGGAVAMETADSTRAFVKDVKRIIIKVGTAVVTGQNGRLAMGRLGSLCEQVKQLN
FQGYEVILVTSGAVGVGRQRLQYRKLIHSSFADLQNPQMDFDGKACAAVGQSGLMAIYDT
MFSQLDVTSSQLLVTDRDFKDPSFGDQLRETVFALLDLKVIPLFNENDAISTRRQPYEDP
SGIFWDNDSLAALLAAELNADLLIMLSDVEGLYSGPPSDPQSKIIHTYVNEKHGKLISFG
EKSRVGRGGMQAKVFAAANAASKGVPVVIASGFATDSIIKVLKGEKIGTLFHNEANLWEC
SKEATAREMAVAARDCSRRLQKLSSEERKKILLDIADALEANEDAIRSENEADVEAAQGA
GYEKSLIARMTLKPGKITNLARSIRAIADMEDPISHTLKRTEVAKDLVFEKAYCPLGVLL
IIFESRPDALVQIATLAIRSGNGLLLKGGKEAMRSNAILHKVITGVIPDAVGKKLIGLVT
SKDEIADLLALDDVIDLVIPRGSKNLVSQIKATTKIPVLGHADGICHVYIDKSADMDMAK
RIVLDAKVDYPAACNAMETLLIHKDLSKSEGLDDLLVELEKEGVVIYGGPIAHDKLKLPK
VDSFRHEYSSMACTLEFVDDVHSAIDHINRYGSAHTDCIITTDEKAAESFLQQVDSAAVF
HNASTRFCDGTRFGLGAEVGISTGRIHARGPVGVDGLLTTRCILRGSGQVVNGDKGVVYT
HRDLPLQ
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atggggaggggagggatcggaggtgcggtggccatggagactgccgactccactcgggca
ttcgtcaaggacgtcaagcgcatcatcatcaaggtgggcacagctgttgtcactgggcag
aatggccgattggctatgggcaggcttgggtctctgtgtgaacaggtgaaacaactgaac
tttcaagggtatgaggtgattctggtaacatcaggcgccgttggtgttgggaggcagagg
ctccagtaccggaagcttatccatagcagcttcgctgatctgcagaacccgcagatggac
tttgatggaaaggcctgtgctgccgttggtcaaagtggtttgatggcgatatatgacacg
atgttcagccaacttgatgtaacgtcatctcaacttcttgtaacggaccgagactttaag
gatccaagttttggggaccagctccgtgagactgtttttgcgctgttggatcttaaagta
ataccactatttaatgagaacgatgccatcagtaccaggagacaaccatatgaggatcca
tctggtatattctgggataacgacagtctggccgctctgttggcagcagaacttaatgct
gaccttcttatcatgctaagtgatgtggagggactttatagtggcccaccaagtgatcct
caatcaaagatcatccacacatatgttaatgaaaaacatgggaagctaattagtttcgga
gaaaagtctcgtgttggaagaggtggcatgcaagctaaagtgtttgctgctgctaatgct
gcatcaaaaggcgtacctgttgtcattgccagtggatttgcaacagatagcattattaaa
gttctcaaaggagaaaagattggtacacttttccacaacgaagcaaatctgtgggagtgt
tccaaggaagctacagcccgagagatggcagttgcagcaagagactgttcaagacgcctg
cagaagttgtcatcagaggagcgtaagaagattttactagatattgctgatgctctagaa
gcaaatgaggatgcaattaggtctgaaaatgaagctgatgttgaagcagcacaaggtgct
ggttatgagaaatcgttgattgctaggatgaccctaaagccaggaaagataacaaacctt
gcaagatccattcgtgcaatcgctgacatggaggaccctatttcccatacattgaaaaga
acagaggttgctaaagacctcgtttttgagaaagcatattgcccactgggtgttctcctc
attatttttgagtctcgccctgatgcattggttcagattgcaactttagcaatccgaagt
gggaatggtcttcttttgaaaggaggaaaagaagctatgagatcaaatgcaatattacac
aaggtcataactggggtgattccagatgctgttggtaaaaagctcattggccttgtgact
agcaaagatgaaattgctgacttgctagcgcttgatgatgtcattgacctagtcattcca
agaggaagtaagaatcttgtctcccagataaaagcaacaaccaagattccagtcttaggc
catgctgatggtatctgccatgtttacattgataaatcagctgacatggatatggcaaaa
cgtatagtattggatgctaaggttgattatccagctgcgtgtaatgcaatggaaacatta
cttattcataaagatctgagcaagagtgagggccttgatgatctattagtggaacttgaa
aaagaaggagtagtcatttatggtggtcctattgcacatgacaaactgaaactgcccaag
gtagattcatttcgtcatgagtatagctcaatggcatgcacccttgaatttgttgatgat
gtgcattcagcaattgatcatataaatcgttatggaagtgcacacacagattgcattatc
acaactgatgaaaaggctgcagaatcttttctgcagcaagttgatagtgcggctgtgttt
cataatgcaagcacaaggttctgtgatgggacgcgctttggtctaggtgcagaggttggc
ataagtactgggcgcatacatgctcgtggacctgttggtgttgatgggcttctaactacc
cgctgcattctacgaggtagtggacaagtggtaaatggtgacaagggagtggtttacacc
cacagggatcttccgttgcaatga

DBGET integrated database retrieval system