KEGG   Setaria italica (foxtail millet): 101778090Help
Entry
101778090         CDS       T02818                                 

Definition
(RefSeq) glutathione synthetase, chloroplastic
  KO
K21456  glutathione synthase [EC:6.3.2.3]
Organism
sita  Setaria italica (foxtail millet)
Pathway
sita00270  Cysteine and methionine metabolism
sita00480  Glutathione metabolism
sita01100  Metabolic pathways
Module
sita_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:sita00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    101778090
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    101778090
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sita04147]
    101778090
Enzymes [BR:sita01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     101778090
Exosome [BR:sita04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101778090
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSH_synth_ATP GSH_synthase
Motif
Other DBs
NCBI-GeneID: 101778090
NCBI-ProteinID: XP_012703427
UniProt: A0A368SAB6
Position
VIII
AA seq 535 aa AA seqDB search
MSSCVSHHHHIQTRVRPRLPVPARLPAAAASFAPPGRRVVTAAMSAEAAPGVEPAEAEPG
AAAGPGQQQAVLLAEMVEDAAVWCALHGLVVGDRADPRSGTVPGVGLVHAPFSLLPSRFP
TSFWKQACELAPIFNELVDRVSLDGEFLQAALSRTKQVDEFTARLLEIHEKMMAINKKEA
IRLGLHRSDYMLDSETNSLLQIELNTISSSFPGLGSLVSELHRTLLNQYGKVLGLDSKRI
PRNWAATQFAEALGKAWAEYNNDSAVVLMVVQPEERNMYDQYWLANHLKESYGVTTVRKT
LAQVEAEGQVLTDGTLVIDGRTVAVVYFRAGYAPTDYPSEAEWKARLLMEQSSAVKCPSI
SYHLVGTKKIQQELAKPNVLERFLDSKEDIAKLRKSFAGLWSLDNEEIVKSAIEKPDLFV
LKPQREGGGNNIYGHDVRDTLIKLQKEQGESLAAYILMQRIFPNASLTPLVRGGDCFEDL
TISELGIYGAYLRNKDKVILNNQCGYLMRTKVSSSNEGGVAAGFAVLDSVLLTDE
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcctgcgtctcgcaccaccaccacatccagacccgcgtccgcccccgcctcccc
gtaccggcccggctccccgcggccgcggcgtcgttcgctccgccggggcgccgggtggtg
acagccgcgatgagcgccgaggcggccccgggcgtggagccggcggaggcggaacccggg
gcggcggccgggccggggcagcagcaggcggtgctgctggccgagatggtggaggacgcc
gccgtctggtgcgccttgcacgggctcgtcgtcggggaccgcgccgacccgagatcagga
acagtacctggcgtcggcctggttcatgccccgttctcgctgcttccatcgcgcttcccg
acgtccttctggaagcaggcgtgcgagctggcccctatcttcaatgagctcgtcgatcgt
gtcagcttggatggggagtttttgcaagctgcgttgtctaggacaaagcaggttgatgaa
ttcactgcaaggctgctagaaattcatgagaagatgatggcaataaataagaaagaggct
atccgcttaggactgcaccgatctgattatatgctggattctgaaaccaattcactgctt
caaatagagctcaacactatttcgtcgtcttttcctggccttggctcccttgtcagtgaa
cttcacaggaccttactcaatcagtatggaaaagttttaggcctagattctaaaaggata
ccacggaattgggctgccactcaatttgctgaagcgttgggcaaagcatgggctgagtat
aacaatgacagtgctgttgttctgatggttgttcaacctgaagaaagaaatatgtacgac
caatattggcttgccaatcatttgaaggaatcatatggtgtgacaactgtaaggaaaacg
ttggcacaagtagaggctgaaggacaggtgcttacagatggaacacttgtgatagatggt
cggacagttgctgttgtgtatttcagagccgggtatgcaccaactgattacccttcggaa
gcggagtggaaagcgaggcttctgatggaacaatcttctgcagtaaagtgcccttcaata
tcttaccatttagtaggaacaaaaaagatccagcaagaactagcaaagccaaacgttctt
gaaaggtttctcgacagcaaggaggacattgccaaactacgtaaaagttttgcaggtttg
tggagcttggataatgaagagattgtgaaatcagcaatagagaaacctgacctgtttgtc
ttgaagcctcagcgagaaggcggaggaaacaacatatatggtcatgatgtgcgagacacg
ctgataaaactccagaaggaacagggggagtcacttgcagcatacatcctgatgcagagg
atttttccaaacgcttctcttactcctttagttaggggtggtgattgctttgaggacctt
acaatctctgagctagggatatatggagcctacttgcggaacaaagacaaggtcatcctg
aataaccagtgtggttacttaatgcgcaccaaagtttcttcatcaaacgaaggtggcgtt
gctgcagggtttgccgttttggatagtgttctcctcactgatgagtga

DBGET integrated database retrieval system