KEGG   Setaria italica (foxtail millet): 101778441Help
Entry
101778441         CDS       T02818                                 

Definition
(RefSeq) photosynthetic NDH subunit of lumenal location 4, chloroplastic
  KO
K01802  peptidylprolyl isomerase [EC:5.2.1.8]
Organism
sita  Setaria italica (foxtail millet)
Brite
KEGG Orthology (KO) [BR:sita00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    101778441
Enzymes [BR:sita01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     101778441
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C
Motif
Other DBs
NCBI-GeneID: 101778441
NCBI-ProteinID: XP_004953941
UniProt: A0A368PRM1
Position
I
AA seq 230 aa AA seqDB search
MAPPVSSLSLSPMASSTIPSPQLPKPSTVRALSVAPCNSAASSSSPSTSSSPPCHAAAPQ
VASAGRRGMLALGAGFLASAALLCPAGDAGATRIEYYATVGDKLCDLNLVKSGLAYCDVE
VGTGAQPPRGELINVHYTARFPDGTVFDSTYKRGRPLTMRIGAGKILRGLEQGISGGGGV
PPMLVGGKRKLMIPATLAYGPEPAGCFSGDCNIPGNSTILYDLFLVGIYK
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggcgcctcccgtctcctccctctccctgtcccccatggcgtccagcacaatcccgtcg
ccgcagctccccaagcccagcaccgtcagggcgctctccgtcgcgccctgcaactccgcc
gcctcctcctcctcaccgtccacctcctcatctcccccgtgccacgccgcggcgcctcag
gtggcgtcggcgggaaggagggggatgctggcgctgggcgcggggttcctggcctcggcc
gcgctgctgtgccccgccggggacgccggggccacgcgcatcgagtactacgcgacggtc
ggggacaagctctgcgacctcaacctcgtcaagtcggggctcgcctactgcgacgtcgag
gtcggcaccggcgcccagccaccgcgcggcgagctcatcaacgtgcactacactgcaaga
tttcccgatggtacggtgttcgacagcacctacaagcgcggcaggccactgacaatgcgc
atcggcgcaggcaagatcctccgtgggcttgagcagggaatcagtggaggtggtggtgtg
ccgcccatgcttgttggtgggaagcgcaagcttatgatacctgcaactctggcgtacggg
cctgaaccagcaggctgcttctcaggagattgtaacattcctggaaactccacaattcta
tatgaccttttcctcgtcggaatttacaagtga

DBGET integrated database retrieval system