KEGG   Setaria italica (foxtail millet): 101778678Help
Entry
101778678         CDS       T02818                                 

Definition
(RefSeq) poly [ADP-ribose] polymerase 2
  KO
K10798  poly [ADP-ribose] polymerase [EC:2.4.2.30]
Organism
sita  Setaria italica (foxtail millet)
Pathway
sita03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:sita00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    101778678
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sita03032]
    101778678
   03036 Chromosome and associated proteins [BR:sita03036]
    101778678
   03400 DNA repair and recombination proteins [BR:sita03400]
    101778678
Enzymes [BR:sita01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     101778678
DNA replication proteins [BR:sita03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     101778678
Chromosome and associated proteins [BR:sita03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    101778678
DNA repair and recombination proteins [BR:sita03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     101778678
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP PARP_reg WGR SAP
Motif
Other DBs
NCBI-GeneID: 101778678
NCBI-ProteinID: XP_004968713
UniProt: A0A368R5A4
Position
V
AA seq 658 aa AA seqDB search
MSARLRVEELRAELQRRGLDDSGNKPALVRRLDAAIRKEEKAALAAAAADGDGIAADGMV
VDGKGNGGDNKKRKRSRNGEEEGSGDASLEVAKLEGMSYRELQGLAKSRGLAANGNKKDV
IERLLSAPANATDGVQDEKRAPKGGVEKVEEEVKKEKMVTATKKGAAVLDQHIPDHIKVN
YHVLQVGDDIYDATLNQTNVGNNNNKFYIIQVLESDGGGSFMVYNRWGRVGARGQDKVHG
PFSTRDQAIYEFEGKFQDKTNNLWSDRKNFKCYAKKYTWLEMDYGETDKETNKTEKKDSI
TDQIKETKLETRIAQFISLICNISMMKQQMVEIGYNADKLPLGKLSKSTILKGYDVLKRI
SNVISKADRRQLEQLTGEFYTVIPHDFGFRKMREFIIDTPQKLKAKLEMVEALGEIEIAT
KLLEDDSSDQDDPLYARYKQLHCDFTPLEANSEEYSMIKTYLMNTHGKTHSGYTVDIVQI
FKVFRHGETERFQKFASTGNRMLLWHGSRLSNWAGILSQGLRIAPPEAPVTGYMFGKGVY
FADMFSKSANYCYASEASRSGVLLLCEVALGDMNELLNADYDANNLPKGKLSTKGVGQTA
PDLSESKTTNDGVVVPLGKPKQEPSKRGSLLYNEYIVYNVDQIRMRYVLHVSFNFKRR
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcgaggctacgggtggaggagctccgcgccgagctgcagcgccgcggcctcgac
gactccggcaacaagccagccctcgtgcggaggctggacgccgcaatccgcaaggaggag
aaggccgcgcttgctgctgcggcagcagatggggatgggatagccgcagatggtatggtc
gtggatggcaaagggaacggcggggacaacaagaaaaggaaaaggtccagaaatggagag
gaagaggggagcggcgacgcctctttggaggtggcaaagctagagggcatgagctaccgc
gagttgcaaggattggccaagtcacggggactggcagcaaatgggaacaagaaggatgtt
atcgagaggttgctgtcagcccctgctaatgccacagatggtgttcaggacgagaagagg
gctccaaaaggtggtgttgagaaggttgaggaggaggtgaaaaaggagaagatggttaca
gccacgaagaagggtgctgcagtgctggatcagcacattcctgatcacataaaagtgaac
tatcatgtcttgcaagtgggtgatgatatctatgatgccaccttgaaccagactaatgtt
ggaaacaacaacaataagttctatatcatccaagttttagaatctgatggtggtggaagc
ttcatggtttacaatagatgggggagagtaggggcacgaggtcaagataaagtacatggt
cctttttcaacacgagaccaggcaatatatgaatttgaggggaagtttcaggacaaaact
aacaacctttggtccgaccgcaagaacttcaaatgttatgcaaagaaatacacttggctt
gaaatggactatggcgaaactgataaggaaacaaataagactgagaagaaagattccatt
actgatcagataaaagagacaaaacttgaaactcggattgcacaattcatatccctgata
tgcaatattagcatgatgaagcagcaaatggtggaaataggttataatgctgataaactt
ccccttggaaagctaagcaaatctacaatacttaagggttatgatgttctgaaaaggata
tccaatgttatttcaaaggcagataggagacaacttgagcaattgactggggaattctac
accgtgattcctcatgactttggtttcagaaagatgcgtgaatttattatcgacactcct
cagaaactaaaagctaagctggaaatggttgaagcccttggtgaaattgagattgcaacc
aagcttctggaggatgattcaagtgaccaggatgatccactatatgctcgatacaagcaa
cttcattgtgacttcacacctcttgaagccaattcagaagaatactccatgataaaaaca
tatttgatgaatacccatggcaaaacacactcgggttatactgtggacatagtgcaaata
tttaaggtgttcaggcatggtgaaacagagcggtttcagaagtttgctagtacaggaaat
aggatgcttctgtggcatggttctcggttgagcaactgggctgggatcctttctcagggt
ttgcgaattgctcctccggaagcacctgtaactggttacatgtttggcaagggtgtttac
tttgctgatatgttttcgaagagtgcaaactattgctatgcttctgaagcatctagatct
ggagtactgcttctatgtgaggttgcattgggtgatatgaatgagctgctaaatgcagat
tacgatgctaataacttgcccaagggaaaactaagcacgaaaggagttggtcaaacagca
cctgacttatcagagtctaagaccacaaatgatggtgtggttgttccccttgggaaacct
aaacaggaaccttccaaaaggggtagcctgctgtacaacgaatacatagtgtacaatgta
gatcagataagaatgcggtatgtccttcatgtctccttcaacttcaagaggcggtag

DBGET integrated database retrieval system