KEGG   Setaria italica (foxtail millet): 101778884Help
Entry
101778884         CDS       T02818                                 

Definition
(RefSeq) vacuolar protein sorting-associated protein 41 homolog
  KO
K20184  vacuolar protein sorting-associated protein 41
Organism
sita  Setaria italica (foxtail millet)
Brite
KEGG Orthology (KO) [BR:sita00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sita04131]
    101778884
Membrane trafficking [BR:sita04131]
 Endosome - Lysosome transport
  Tethering complex
   Hops complex
    101778884
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin WD40 ANAPC4_WD40 zf-RING_2 PQQ_3
Motif
Other DBs
NCBI-GeneID: 101778884
NCBI-ProteinID: XP_004960100
UniProt: A0A368QAN6
Position
III
AA seq 950 aa AA seqDB search
MSTERRAHPPLQNGAGGDDGDDEREEEDGDEGEEELEDEAEEEEEEPRLKYQRLGGSVPA
ILSTDAAASIAVADRMVALGTHNGTLHILDFQGNQVKEIAAHTATVNDISFDADGEYIGS
CSDDGTVAISSLFTDEKLKFEYHRPMKAIALDPNYSRNYRRFATGGLAGQVLVLTKKTWG
GYHKKVLRDGEGPIHSMKWRTDLLAWANDAGVKVHDMKTDKGIAFIERPKGIPRPEFLLP
HLVWQDDTVLVIGWGTSVKIAAIRTDSSQGLNGIQRTIAAVGSEKYVDIVGSFQTGYHIS
GIAPFGDLLVVLAYIPDEDEKEKKISTSVTSRQGTAQRPEIHLVSWKNDEVTTDALPIHG
YEHYKAKDYALAHAPFSGSSNAGGQWAAGDEPLYYIVSPKDIVVAKPRDAEDHIAWLLQH
DCHEKALAAVEAGQGPTELLDEVGSRYLDHLIIERKYAEAAQRCPKLLRGSPSAWERWVF
HFAHLRQLPVLVPYIPTENPQLSDTAYEVALVALTTNPSFHELLLTTVKNWPPTLYSASP
VISAIEPQLDSSSMTDTLKEALAELYVINSQYEKALSLYAELLKPEVFEFIEKYNLHDAI
RDKVVNLMILDSKRTVHLLIQHRDIIPPYEVVEQLLHTNKKCDKRHFLHLYLHALFEIDI
HAGKDFHDMQVELYADYEQRMLLPFLRTSQHYRLDKAYEIFAQRELVREQVFVLGRMGNA
KEALSTIINKLENIEEAVEFVMDQHDDELWDELIRQCLQKPEMVGMLLEHTVGNLDPLYI
VSLVPDGLEIPRLRDRLVKIVTDYRTETSLRNGCNDILKADCVNLLVKYYHEARRGVYMA
SMDEEVHGNRVDDGSSRANERSSSVRALDIKSRTRCGARCCLCFDPLPIQDISVILFYCC
HAYHLSCLEGGLDLMRSNSNQDTDNGSDDEDGSPSGESRMRCVLCTTASA
NT seq 2853 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccgagcggcgcgcccacccgccgctgcagaacggcgcggggggagacgacggg
gacgacgagcgggaggaggaggacggcgacgagggggaggaggaattggaggatgaggcg
gaggaggaggaggaggagccgcggctcaagtaccagcggctgggcgggagcgtgccggcg
atcctctccaccgacgccgccgcgtccatcgccgtcgccgaccgcatggtcgcgctcggc
acccacaacggcaccctccacatcctcgacttccagggcaatcaggtgaaggaaattgct
gcccacacggcaactgtcaatgacatcagctttgacgcagacggtgaatatataggcagc
tgctcagatgatggcacagtagcaataagcagcctcttcactgatgaaaaactgaagttt
gagtaccatcgccccatgaaagcaattgctctagaccctaattattcccggaactatagg
agatttgctactggtggtttagcaggtcaagtacttgtgttgacaaagaagacttggggt
ggttaccataagaaggttttgcgtgatggcgaagggccaatccattctatgaagtggaga
acagacctacttgcttgggctaacgatgcaggggtgaaagtgcatgatatgaaaacagac
aaaggaattgcattcatagagcgaccgaaaggcattcctcggccagagttcttacttccc
cacctagtatggcaggatgatactgtcttagttattggatggggaacaagtgtcaagatt
gcagcaattcgaacagattcatctcagggactcaatggcatacaaaggaccatcgctgca
gtgggttccgagaagtatgtagatattgttggttcattccaaacaggctaccacatatct
gggattgctccttttggtgaccttttagttgtgctcgcctatattcccgatgaggatgaa
aaagagaaaaaaattagtacttctgttacttcacgacagggaactgcacagcgtcctgaa
atacatcttgtgtcatggaaaaatgatgaagttactacagatgctctgcctattcatggt
tatgaacattacaaggcaaaagattatgctcttgcgcatgcacctttctcaggaagtagc
aatgcaggtggacagtgggctgctggcgacgaacctttgtattacatcgtgtctcctaag
gatattgtggtggcgaaaccaagagatgctgaagatcatattgcttggcttcttcaacat
gattgtcacgaaaaagcattggctgctgttgaggcagggcaagggccgactgagcttctt
gatgaggttggttcaagataccttgaccacttgataattgaaagaaaatatgctgaagct
gctcaacgctgtccaaagttgctgcgaggatctccttcagcatgggagagatgggtcttt
cactttgctcatctccgccaacttcctgttttggtcccatatatacctacagaaaatcct
cagctgagtgatactgcatatgaggttgcccttgttgctctaactaccaatccttctttc
catgaacttctgctgaccactgtaaaaaattggccacctacactgtactcagcttcacct
gtcatatctgccattgagccacagctcgactcatcatcgatgactgatacattgaaagag
gcgttagctgagttgtatgtaatcaatagtcaatatgaaaaggcactttccctgtatgct
gaactcctgaagccagaagtattcgagtttattgaaaagtacaacttgcatgatgccatt
cgtgataaggtcgtcaatcttatgatactggatagtaaaagaacagttcacctactgatc
caacatcgtgatatcattcccccatatgaagttgtggagcagttgttgcataccaataaa
aaatgtgacaagagacattttttgcacctatatttgcatgctctatttgagatagatata
catgctggaaaagattttcatgatatgcaggtggagctttatgcagactatgagcaaagg
atgctactacccttcctccgtactagtcagcattacaggcttgacaaggcatatgaaatc
tttgcacaaagggaacttgtaagggaacaggtttttgtccttggtcgaatgggcaatgct
aaagaagctctttcaacaatcataaacaaactggaaaacatagaggaggctgttgaattt
gttatggaccaacatgatgacgaactatgggatgaactgattagacagtgcctccagaag
cctgaaatggttgggatgctattggaacatactgttggcaatcttgatcctctgtacatt
gtcagtttggttcctgatgggttagaaatacctcggttgcgggatcggcttgtgaaaatt
gtgacggactaccggacggaaacttcactgcgaaatggatgcaacgatatacttaaggct
gactgtgtgaaccttttggttaaatactaccacgaggctcggcgtggagtttacatggca
agcatggacgaggaggtacatggaaacagggttgatgatggatcatcgcgagcaaatgag
agatcatccagtgttcgggctctagatattaagtccagaacgagatgtggtgcccggtgt
tgcttatgcttcgatcctttgccaattcaggacatatccgtcattttgttctactgctgc
catgcgtatcatctatcttgcttggaaggtgggttggacttaatgagatcaaacagtaat
caggatactgacaatggctcagacgacgaggatggttccccgtctggtgagtctcgtatg
cgctgtgtattgtgcactactgcctctgcataa

DBGET integrated database retrieval system