KEGG   Setaria italica (foxtail millet): 101779112Help
Entry
101779112         CDS       T02818                                 

Definition
(RefSeq) (DL)-glycerol-3-phosphatase 2
  KO
K17623  pseudouridine 5'-phosphatase [EC:3.1.3.96]
Organism
sita  Setaria italica (foxtail millet)
Brite
KEGG Orthology (KO) [BR:sita00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sita01009]
    101779112
Enzymes [BR:sita01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.96  pseudouridine 5'-phosphatase
     101779112
Protein phosphatases and associated proteins [BR:sita01009]
 HAD phosphatases
  Other HAD phosphatases
   101779112
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAD_2 Hydrolase HAD Hydrolase_like
Motif
Other DBs
NCBI-GeneID: 101779112
NCBI-ProteinID: XP_004973077
UniProt: K3YLI8
Position
VI
AA seq 244 aa AA seqDB search
MPSEDAADATPAAAPPPRAAISHVIFDMDGLLLDTEGFYTAVQEKILARYGKVFDWSVKA
KMMGKTTAESTRILFEECGLTGLLTTEQFLEEREIMLKELLPTCVAMPGVVRLIHHLHAN
GIPLAVATGTHKHHFALKTQNHQEIFSLMHHIVTGDDPDVKAGKPSPDIFLAAMRRFECD
VEPNNCLVFEDAPLGVAAAKTAGMHVVMVPDARLDVSHHKEADQVLSSLLDFNPSSWGLP
LFKD
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgccatccgaggacgccgccgacgctactcccgcggcggcgccgcctcccagggccgca
atctcgcacgtcatcttcgacatggacggcctcctcctcgacacggagggtttctacacg
gcggtgcaggagaagatcctggcgaggtacggcaaggtgttcgactggtccgtcaaggcg
aagatgatgggcaagacgaccgccgagtccacgcgcatcttgttcgaggagtgcggcctc
accggcctgctcacaacggagcagttcctcgaggagcgcgagatcatgctcaaggagctc
ttgcccacctgcgttgccatgccaggtgtagtacgcctgatccatcatctccatgctaat
gggataccactagctgttgcaacaggaacccataaacatcactttgcactaaagacacaa
aaccaccaggaaatattctccctgatgcatcatattgtcacgggggatgatccagatgtg
aaggctggcaagccatctccagatattttcctggctgccatgaggagatttgagtgtgat
gtagaacccaataattgcttggtttttgaagatgcaccattgggtgttgcagcagcaaaa
actgctggaatgcatgtagtgatggttccagatgcaaggttggatgtttcacatcacaaa
gaagctgaccaagttctcagttcactactggatttcaatcctagctcatggggcttgcca
ctgtttaaggattag

DBGET integrated database retrieval system