KEGG   Setaria italica (foxtail millet): 101779408Help
Entry
101779408         CDS       T02818                                 

Definition
(RefSeq) glyoxylate/hydroxypyruvate reductase HPR3
Organism
sita  Setaria italica (foxtail millet)
SSDB OrthologParalogGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 AdoHcyase_NAD F420_oxidored Shikimate_DH IlvN ThiF ApbA
Motif
Other DBs
NCBI-GeneID: 101779408
NCBI-ProteinID: XP_004974989
UniProt: A0A368RQQ5
Position
VII
AA seq 357 aa AA seqDB search
MGSQLGVASRLPPLCHCQPEPAMASSAASGEEPAPLLPALLFFRLRMDDDFDAALRQRYR
VLDFFVSGEPLPAFLAGAAALPDPPRAAVVMGGAAARVDAALLDAVPSLGFVFSTGAGVD
HIDLAECARRGVAVANSGTVYSTDVADHAVGMIIDVLRRVSAAERFVRSGLWPAQGDYPL
GTKLGGKRVGIIGLGNIGSLIAKRLEAFGCIIHYNSRRPRDSVPYKYFFNVHDLALESDV
LVVACALNKDTRHIVNKDVLEALGKDGIIINIGRGANVDEAELIRALKEGRIAGAGLDVF
ENEPKVPAELFSMDNVVMTSHVAVFTSESRSDLWDTTIGSLEAFFSGKPLLRQVLPW
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgggctcccaactcggtgtggcctcgaggcttccacctctctgtcactgtcaacccgaa
ccagccatggcatcctccgcggcgtccggcgaggagccggcccctctcctcccggccctc
ctcttcttccggctccgcatggacgacgacttcgacgccgcgctgcgccagcgctaccgc
gtcctcgacttcttcgtgtcgggcgagcccctccctgcttttctcgccggcgccgcggcc
ttgccggacccgccccgcgccgcggtcgtcatgggaggcgccgccgcccgcgttgacgcc
gcgctcctcgacgccgtcccgtccctcggattcgtcttcagcaccggcgccggcgttgac
cacatcgacctcgccgagtgcgcgcgccgcggcgtcgccgttgccaactccggcacggtc
tactccaccgacgtcgccgaccacgctgtcggcatgatcatcgacgtgctgaggcgcgtc
tcggcggccgagcggttcgtccgcagcggcctctggccggcgcagggggactaccccctc
ggcaccaagctaggcggcaagcgtgttggcatcattggattggggaacattggttcactg
attgcaaagaggcttgaagcatttggttgtatcatccactacaactccagaagaccaagg
gattcagtcccctacaaatacttctttaatgttcatgatctcgctttagaatcagatgtg
cttgttgtggcatgtgcattgaacaaggacacacggcatattgtcaacaaggatgttcta
gaggccctgggaaaggatgggatcatcataaacatcggtcgaggagcaaacgtcgacgag
gcagagttgatcagggcgctgaaagagggaaggattgcaggagctgggcttgatgtcttt
gagaatgaacccaaggtgccagcagagctcttctccatggacaatgtggtaatgacgtcc
catgttgcggttttcacatcagagtccaggtctgacttgtgggacaccacaatcggtagc
cttgaagccttcttctctgggaagccgttgctcaggcaggtgcttccctggtag

DBGET integrated database retrieval system