KEGG   Setaria italica (foxtail millet): 101779497Help
Entry
101779497         CDS       T02818                                 

Definition
(RefSeq) uncharacterized protein LOC101779497
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
sita  Setaria italica (foxtail millet)
Pathway
sita00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sita00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    101779497
Enzymes [BR:sita01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     101779497
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB Phos_pyr_kin CH
Motif
Other DBs
NCBI-GeneID: 101779497
NCBI-ProteinID: XP_004969456
UniProt: K3XJA5
Position
V
AA seq 361 aa AA seqDB search
MAQARVRLPPAGPTPATAFLSGSNPRPAHLPFSSKRAPASLSAVAATNAPIVVVGSANAD
IYVEVDRLPLVGETVAARAGRSLAGGKGANQAACGGRLALGPTYLVARVGDDANGRLLEG
ALADAGGVRTDRVARAPDAPSGHAVVMLMPDGQNSIIIVGGANMEGWAAGIGAEDLELIQ
KAGVLLLQREIPDWVNVQAAQAAKSAGVPVIMDAGGMDAPVPGELLRLVDIFSPNETELA
RLTGLPTESFEQINQAAGQCHKMGVKEVLVKLGSQGSALFVEGEEPIRQPIIPATEVIDT
TGAGDTFTSAFAVALVEGKPKKECMRFAAAAASLCVRVKGAIPSMPDRKSVMKLLESVQV
E
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggctcaggcacgcgtgcgcctccctcccgccggcccaacgccggccaccgccttcctc
tcgggctccaacccaagacccgcccaccttcccttctcctcgaagcgcgcccccgcctcc
ctctccgccgtcgccgccaccaatgcccccatcgtcgtcgtgggctccgccaacgccgac
atctacgtcgaggtcgaccgcctcccgctcgtcggcgagaccgtggcggcccgcgcgggc
cgcagcctcgcgggcgggaagggcgccaaccaggcggcctgcgggggaaggctcgcgctg
ggccccacctacctcgtggcgcgcgtgggggacgacgccaacgggcggctcctcgagggc
gcgctggccgacgccggcggcgtccgcaccgaccgcgtcgcgcgcgcgcccgacgcgccc
tcgggacacgccgtcgtcatgctcatgcccgacggccagaactccatcatcatcgtcggc
ggcgccaacatggagggctgggcggcggggatcggcgcggaggacctggaattgatccaa
aaggcaggcgtgctgctgctgcagagggagatacccgattgggtcaacgtgcaggctgcg
caggctgcaaaaagtgccggtgtgcctgttatcatggatgctggtggaatggatgctcct
gtccccggagaactactcagactcgtcgacatttttagtccaaatgaaacagaattagca
cgtttgactggtctacctactgaatcatttgaacagatcaaccaagctgcaggacaatgc
cacaaaatgggcgtgaaagaagtactagtaaagcttggatcacaaggatctgctttgttt
gttgagggggaggagccaatcagacagccgattattcctgccacagaagttattgatacc
acgggggctggtgacactttcacctcagcttttgctgtagctctggttgaggggaagcct
aagaaggagtgcatgagatttgctgctgctgctgcctctttgtgtgttcgagtgaagggg
gctatacccagcatgcctgacagaaaatcagtgatgaagctgctggaatctgtgcaagtt
gagtaa

DBGET integrated database retrieval system