KEGG   Setaria italica (foxtail millet): 101780932Help
Entry
101780932         CDS       T02818                                 

Definition
(RefSeq) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
sita  Setaria italica (foxtail millet)
Pathway
sita00780  Biotin metabolism
sita01100  Metabolic pathways
Module
sita_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:sita00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    101780932
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sita01007]
    101780932
Enzymes [BR:sita01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     101780932
Amino acid related enzymes [BR:sita01007]
 Aminotransferase (transaminase)
  Class II
   101780932
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP Aminotran_5
Motif
Other DBs
NCBI-GeneID: 101780932
NCBI-ProteinID: XP_004983657
UniProt: K4A9V8
Position
IX
AA seq 450 aa AA seqDB search
MAQWDALVDAALARLEARSLLRATRPIALAPPPAAPETFAGPGPWDRAAVEIRFDRDTLH
QWLAEGGETGEQEEKLDGNLILFSGNDYMGLSSHPAVREAAVKAAQEYGMGPRGSALICG
YTTYHKLVEESLAELKRKEDCLLCPTGFSANMAVMTALGSISSLLAAGRKPAEDERIAIF
SDALNHASIIDGIRLLERQQEAVVFVYKHCDMFHLDFLLSSCSMEKKVVVTDSLFSMDGD
FAPFPELVKLRRKYGFLLVIDDAHGTLVCGENGGGAAELFECENDIDISVGTLSKAAGCQ
GGFIACSTRWKNLIQSRGRSFIFSTALPVPVVASVHAALYVSRKERWRRSAVWRHVQYFA
SLTKVDITSPIISIVVGSEEAALRAGRHLLRSGFHVTPIRPPTVPPNSCRLRVTLSASHS
SDDIKRLVDALTPWLPDKYAEQTYATLSKL
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagtgggacgcgctggtggacgccgcgctcgcgaggctggaggccaggagcctg
ctgcgtgccacgcgccccatcgcactcgcgccgccgcccgccgccccggagaccttcgcc
ggcccggggccctgggaccgcgccgccgtcgagatccggttcgaccgcgacacgctccac
caatggctcgctgaaggtggtgagacgggtgagcaggaagagaagctggacgggaatctg
attcttttctccgggaatgactacatgggcctcagctcgcatccggcagtccgcgaggct
gcagtgaaggcagcgcaagagtatggcatggggccaagaggctctgcgttgatatgtgga
tatactacttatcacaaattggtggaagaatcattggcagagctgaagagaaaggaggat
tgccttctttgccccactggattttccgccaacatggctgtgatgacagccctggggagt
atcagctctcttttggctgctgggagaaaacctgcagaggatgagagaatcgcaatcttc
tcagatgcactgaaccatgcttcaatcattgatgggattcgccttttggagcgacagcaa
gaagcggtagtgtttgtttacaagcactgtgacatgttccatcttgatttcctgctgtcc
agttgctcaatggagaagaaagttgttgtcacagatagcctgttcagcatggatggtgat
tttgctccattccctgaacttgtcaaattacgcagaaagtatgggtttttgttggtcatc
gatgatgctcatgggacacttgtttgtggtgagaatggtggtggtgcagctgaactgttt
gaatgtgaaaatgacattgacattagtgttggcaccttaagcaaagctgctggctgccaa
ggtggttttatagcatgcagcactagatggaagaatttgattcaatcacgaggtcgctca
ttcatattttcgactgctttgccagtgccagtagttgcttctgtgcacgcggccctttat
gtctcaaggaaggagagatggcgaagatcagcagtctggaggcatgtgcagtattttgca
tctttgaccaaagtcgacataactagccccataatatccattgtagttggaagtgaagaa
gcagcacttagggctggcaggcatttgctaagatctggatttcatgttacaccaatccga
ccacccacagtgccacctaactcctgcaggttacgagttactcttagcgcttctcattcc
tcagatgatatcaaaaggctggttgatgcactcacaccctggcttcctgacaaatatgct
gagcagacttacgctacgttgtcaaaactctaa

DBGET integrated database retrieval system