KEGG   Setaria italica (foxtail millet): 101781847Help
Entry
101781847         CDS       T02818                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme 7
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
sita  Setaria italica (foxtail millet)
Pathway
sita00052  Galactose metabolism
sita00500  Starch and sucrose metabolism
sita01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sita00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101781847
   00500 Starch and sucrose metabolism
    101781847
Enzymes [BR:sita01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     101781847
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Fur_reg_FbpA
Motif
Other DBs
NCBI-GeneID: 101781847
NCBI-ProteinID: XP_004960196
UniProt: K3Z4V1
Position
III
AA seq 588 aa AA seqDB search
MAGLPLSAVAFYLCLLASSSSALRVAPATTSEGRHVRRTAYHFQPAKNWQNDPNGPMYYN
GMYHFFYQYNPHGALWDIGNLSWGHSVSGDLVNWAALDTAIDPTAPFDINGCWSGSATIL
RGGTPAILYTGIDANKEQVQNLAFPKNPADPLLREWHKPSYNPVIPLPADVPGDKFRDPS
TAWLGRDGLWRIAVSAEVSGVASTLVYRSADFVHWERNDAPLHSSRAAGMVECPDLFPVK
AHGEEGGLDTSASGAGVSHVLKLSVMDTLQDYYMVGRYDDAADAFVPAEPERGDDVRNWR
RFDYGHVYAAKSFFDARRNRRVLWAWANESDSQADDVARGWSGVQTVPRKLWLDKDGKQL
RQWPIEEIETLRRKRVGLRRNTMLSAGAMNEIVGIAEAQADVEVAFRIPSLEEAEALDSN
WLLDPQKLCGEKGASVPGGVGPFGLIVMASGDLQEHTAVFFRVFRHDDKYKVLMCTDLTR
SSARAGVYKPPYGGFVDIDIEERKTIKLRTLVDHSVVESYGAEGRACITARVYPEHVETS
NSHMFVFNNGTDKVKVTKLEAWELAAATVNVGDEGLIVSESKDESESY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atggcgggtcttcctctctccgccgtcgctttctacctctgcctcctcgcgtcttcgtct
tccgctcttcgcgtagcccccgcgaccacgagcgagggccgccatgtccgcaggacggcc
taccacttccagcccgccaagaactggcagaacgatccgaatggaccgatgtactacaac
ggcatgtaccacttcttctaccagtacaacccgcacggcgcgctctgggacatcggcaac
ctctcctggggccactccgtctccggcgacctcgtgaactgggccgccctcgacaccgcg
atcgacccgacggcgccctttgacatcaacggctgctggtccggctccgccaccatcctc
cgcggcggcacccccgccattctgtacacgggcatcgacgccaacaaagagcaggtgcag
aacctggcgttccccaagaacccggccgacccgctcctccgcgagtggcacaagcccagc
tacaaccccgtcatcccgctcccggccgacgtccccggcgacaagtttcgggacccctcg
acggcgtggctcggccgcgacgggctctggcgcatcgcggtgtccgccgaggtcagcggc
gtggcgtccacgctggtgtaccggagcgcggacttcgtccactgggaacgcaacgacgcg
ccgctgcactcgtcgcgcgccgccggcatggtcgagtgcccggacctgttcccggtgaag
gcgcacggcgaggagggcgggctcgacacttcggcgagcggcgccggggtgagccacgtg
ctcaagctcagcgtgatggacaccctccaggactactacatggtcggccggtacgacgac
gccgcggacgcgttcgtgccggcggagccagagcgcggcgacgacgtccggaactggcgg
cgcttcgactacgggcacgtctacgcggccaagtccttcttcgacgcccgcaggaaccgg
cgcgtgctgtgggcctgggccaacgagtccgacagccaggccgacgacgtcgccaggggc
tggtccggcgtccagacggtcccgaggaagctgtggctggacaaggacggcaagcagctg
cggcagtggcccatcgaggagatcgagacgctgaggaggaaacgcgtcggcctccgccgt
aacacgatgctgagcgccggagccatgaacgagatcgtcggcatcgccgaggcgcaggcg
gacgtggaggtggcgttcaggatcccgagcctggaggaggccgaggcgctcgactccaac
tggctgctggacccgcagaagctgtgcggggagaagggcgcctccgtgcctggcggcgtc
ggcccgttcgggctcatcgtcatggcctccggcgacctgcaggagcacaccgccgtcttc
ttccgggtgttcaggcacgatgacaagtacaaggtgctcatgtgcaccgacctgacaagg
tcatctgcgagggctggggtttacaagcccccctacggaggattcgttgacatcgacatt
gaggagcgcaagaccatcaaactaagaaccctggttgatcactcggtggtggagagctac
ggcgctgaggggagggcctgcatcacggcacgggtgtaccctgagcacgtggagacgagc
aacagccacatgttcgtgttcaacaacgggacggacaaggtgaaggtgaccaagctcgag
gcgtgggagctcgcggcggcgaccgtgaacgttggagacgaaggcttgattgtgtctgaa
tccaaagacgaaagcgaatcctattag

DBGET integrated database retrieval system