KEGG   Setaria italica (foxtail millet): 101782965Help
Entry
101782965         CDS       T02818                                 

Definition
(RefSeq) alpha-amylase type A isozyme
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
sita  Setaria italica (foxtail millet)
Pathway
sita00500  Starch and sucrose metabolism
sita01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sita00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101782965
Enzymes [BR:sita01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     101782965
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amyl_C2 Alpha-amylase Glyco_hydro_70
Motif
Other DBs
NCBI-GeneID: 101782965
NCBI-ProteinID: XP_004966428
UniProt: K3XX03
Position
IV
AA seq 436 aa AA seqDB search
MGMGSRHMCCLSTLLLLLGLSSGQVLFQGFNWESSKQTGGWYNNLMGKVDDIAAAGVTHV
WLPPPSHSVSSEGYMPGRLYDLDASKYGTAAELKSLIAAFHDKGVQAVADIVINHRCADY
KDSRGIYCIFEGGTPDSRLDWRAHMICRDDAKYSDGTGNLDTGADFPGAPDIDHLNDRVQ
RELTEWMLWLKSDLGFDAWRLDFARGYSAEVARVYINGTAPSFVVAEIWDKMVPAGDDGK
PAYDQDPHRQALVDWVDKVGGAASPATVFDFTTKGILNAAVEGELWRLIDTEGKAPGVIG
WWPAKAVTFVDNHDTGSTQAQWPFPHDKVMQGYAYILTHPGNPCIFYDHFFDWGFKDEIA
ALVAVRKRNGITPTSELTILEHDGDAYVAEIDGKVIVKIGSRYDLGHLIPVGFEVATHGK
DYAVWEKGGSEEVTRA
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggggatggggagcaggcacatgtgctgcctgtcgaccctgctcctcctcctgggactg
tcatccggccaggtcctgttccaggggttcaactgggagtcgtcgaagcagacgggtggg
tggtacaacaacctgatggggaaggtcgacgacattgctgccgctggcgtcacgcacgtc
tggctcccgccgccgtcccactccgtctccagcgaaggttacatgcctggtcgtctatac
gacctggacgcgtccaagtacgggacggcggcggagctcaagtccctgatcgccgcgttc
cacgacaagggcgtgcaggcggtggcggacatcgtcatcaaccaccggtgcgccgactac
aaggacagccgcggcatctactgcatcttcgagggcggcacacccgacagccgcctcgac
tggcgcgcccacatgatctgccgcgacgacgccaagtactcggacggcacaggcaacctc
gacacgggcgccgacttccccggagcccccgacatcgaccacctcaacgaccgtgtccag
cgggagctcaccgagtggatgctatggctcaagtctgacctaggcttcgacgcatggcgc
ctcgacttcgccaggggctactctgcagaggtcgccagagtctacatcaatggcacggcc
ccgagcttcgtcgtcgccgagatatgggacaagatggtgcctgctggcgacgacgggaag
cccgcgtatgatcaggacccgcaccggcaggcactggtggattgggtggacaaggtgggc
ggagcggcgtcgccggccacggtgttcgacttcaccaccaaggggatcctgaacgccgcc
gtggagggtgagctgtggaggctcatcgatacggaggggaaggcgcccggcgtcatcggg
tggtggccggcgaaggccgtcaccttcgtcgacaaccacgacacgggctccacgcaggcc
caatggccgttcccccacgacaaggtcatgcagggctacgcctacatcctcacgcacccc
ggcaacccatgcattttctatgaccatttcttcgactgggggttcaaggacgagatcgca
gcactggttgcggtgcggaagcgcaatggcatcacgccgacgagcgagctgacgatcctc
gagcatgatggcgacgcctacgtggcggagatcgacggcaaggtgatcgtgaagatcggg
tccaggtacgacctcgggcaccttatcccggtagggtttgaggttgctacccacggcaag
gactacgccgtctgggagaaaggcggcagcgaagaagtgactcgggcatag

DBGET integrated database retrieval system