KEGG   Setaria italica (foxtail millet): 101783950Help
Entry
101783950         CDS       T02818                                 

Definition
(RefSeq) glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
sita  Setaria italica (foxtail millet)
Pathway
sita00030  Pentose phosphate pathway
sita00480  Glutathione metabolism
sita01100  Metabolic pathways
sita01110  Biosynthesis of secondary metabolites
sita01200  Carbon metabolism
Module
sita_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
sita_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:sita00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    101783950
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    101783950
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sita04147]
    101783950
Enzymes [BR:sita01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     101783950
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     101783950
Exosome [BR:sita04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   101783950
  Exosomal proteins of colorectal cancer cells
   101783950
  Exosomal proteins of bladder cancer cells
   101783950
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-GeneID: 101783950
NCBI-ProteinID: XP_004953000
UniProt: K3YRN6
Position
I
AA seq 516 aa AA seqDB search
MSGRSSVSSPFSGENSFSSLSSFKDLGLSSESGCLSIVVLGASGDLAKKKTFPALFHLFQ
QGFLQSEEVHIFGYARSNLSDDGLRERIRGYLKGSDEHLSQFLQLIKYVSGSYDRGEGFE
LLNKAISEYETSKNNESGSYRRLFYLALPPSVYPSVCKMIRSYCMNPSSHAGWTRVIVEK
PFGKDLDSAEELSAELGKLFEEEQLYRIDHYLGKELVQNLLVLRFANRLFLPLWNRDNIA
NVQIVFKEDFGTEGRGGYFDQYGIIRDIIQNHLLQVFCLVAMEKPVSLKPEHIRDEKVKV
LQSVEPIKHEEVVIGQYDGYKDDPTVPDDSNTPTYASVVLRVHNERWEGVPFILKAGKAL
NSRKAEIRVQFKDAPGDIFRCKKQGRNEFVIRLQPSEAMYMKLTVKKPGLEMATEQSELD
LSYGMRYQDVKIPEAYERLILDTIRGDQQHFVRRDELRAAWEIFTPLLHDIDAGKLKSVP
YQPGTRGPQEADDMSRRMGYVQTHGYIWVPPTLAKF
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggacgctcatctgtatcttccccattttctggggaaaatagcttcagctctctg
tcaagtttcaaggaccttggactatcttcagagtccggttgcttgtccattgttgtacta
ggtgcttctggagaccttgctaagaagaaaactttcccagcactctttcacctttttcag
cagggatttctgcaatctgaagaagtccatatatttgggtatgccagatcaaatctttct
gatgatggattaagagaacgcatccgtggatacctcaaaggttcagatgaacatctttct
caatttttgcagctaattaaatatgttagtggttcctatgatcgtggggaaggatttgag
ttattaaacaaggcaatctctgagtatgaaacatcaaaaaacaatgaatcgggaagctat
cgcagactattttatttggcattgcctccatcagtctacccatccgtatgcaaaatgata
agatcatattgcatgaatccgtcttcacatgctggttggacaagagttattgttgaaaag
ccctttggaaaggatttggactctgcagaggaactgagtgccgaacttggaaagctgttt
gaagaagaacaactctacagaattgaccactatttaggaaaagagctggttcaaaacttg
ctcgtgcttcgttttgcaaaccgcttatttttgcctctctggaatcgtgataatattgct
aatgtacagatcgtatttaaggaggactttggaaccgagggacgtggaggatattttgat
caatatggtatcattcgtgatatcattcagaatcatttgttgcaggtcttctgtttggtg
gctatggaaaagcctgtctctcttaaacccgagcacattagagatgaaaaagtcaaggtt
ctgcaatcagtggagcctataaagcatgaagaggtagtcattggacaatatgatggctac
aaggatgaccctactgtgccagatgactccaacacccctacttatgcatctgttgtactg
agggtacacaatgaaagatgggagggagttccattcattctcaaggctggtaaagctcta
aattctaggaaagcagagatacgtgtgcaattcaaggatgctcctggtgacatttttaga
tgcaagaaacaaggaaggaatgagtttgttatacgcctgcagccatcagaagccatgtat
atgaagttaacagtcaagaaacctggactggaaatggcaactgaacaaagcgaactggat
ctatcctacgggatgcggtaccaagatgtaaaaatcccagaagcatatgagcgtcttatc
ttggacacgataagaggtgatcagcagcactttgttcgccgagatgaactgagggctgca
tgggagatcttcactcctttgcttcacgacatcgatgctggcaagctgaagtccgttcca
taccaaccaggaacccgaggaccacaggaggccgatgatatgagcaggaggatggggtat
gtgcagacccatggctacatatgggtgccgccaaccctcgctaagttttag

DBGET integrated database retrieval system