KEGG   Setaria italica (foxtail millet): 101784161Help
Entry
101784161         CDS       T02818                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: farnesyl pyrophosphate synthase 1
  KO
K00787  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
sita  Setaria italica (foxtail millet)
Pathway
sita00900  Terpenoid backbone biosynthesis
sita01100  Metabolic pathways
sita01110  Biosynthesis of secondary metabolites
Module
sita_M00366  C10-C20 isoprenoid biosynthesis, plants
Brite
KEGG Orthology (KO) [BR:sita00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    101784161
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:sita01006]
    101784161
Enzymes [BR:sita01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     101784161
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     101784161
Prenyltransferases [BR:sita01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   101784161
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-GeneID: 101784161
NCBI-ProteinID: XP_022680711
Position
III
AA seq 440 aa AA seqDB search
MQVIRRPTDRPRAHIVARRRADHRDARIVGEDRPAGRLKEGIETTGALASSIASHVPSGX
LSAGLSLAVLASPGEIIRRASRLEDELKELLRVDGGGRATGPQAGEQQGAGGQQTKERFL
RAYERLKSQDELLNDRAFNLDFTEETRQWLAKMLDYNVPGGKLNRGLSMIDNYMLLREGT
EVDDLDFYLARVLGWCVEWLQASGLVLDDIMDNAYTRRDQICWFRRPTRLIKKYFREKTY
YIDISELWNEIALQTSLGQMLDLISTHNGADELAKYNIEGYRRIVKYKTSYYSFYLPVAC
ALLLSGAKLENFSELRDILIEMGIYFQAQDDYLDCFANPNTIGKIGTDIEDHKCSWLIVQ
ALGHANINQIEVLLKNYGKKDSTSVSKVKSTYSTLDLKDMFSEFEDRAYNHLVTSIEAQH
DRAAQEILKSFLKKIHRRKR
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtgatccgccggccgaccgaccggcctcgcgcgcacatcgtcgctcgccgtcga
gcggaccaccgtgacgcgcggatcgtgggagaagatagaccggccggccgactgaaggag
gggatcgagacgacgggggccctggcgtcgtcgatcgcgtcgcacgtgccgtcggggntg
ctgagcgcggggctgtcgctggcggtgctcgcgagccccggcgagatcatccggcgggcg
tcgcggctcgaggacgagctcaaggagctgctccgggtggacggcggcggccgcgcgacg
gggccgcaggcgggggagcagcagggcgccggcgggcagcagaccaaggagaggttcctg
cgcgcgtacgagcggctcaagagtcaagacgagctcctcaacgaccgcgcgttcaacctc
gacttcaccgaggagaccaggcagtggctcgccaagatgctggactacaacgtacctgga
ggtaaactgaaccgtgggctctcgatgatcgacaactacatgctgctgagggaagggaca
gaggtcgacgacttggacttctacctggcccgcgtgctcggttggtgcgtcgagtggctc
caagcgtctggtcttgtgctagacgacatcatggacaacgcgtacacgaggcgagatcag
atttgctggttccgacgacctacacgtttgatcaaaaagtactttagagaaaaaacttac
tatattgatatctctgaattatggaacgagatagctctgcagacatctttaggacagatg
cttgatcttattagcacacataatggggcagatgaacttgcaaaatacaatatagaaggg
taccgtcgtattgtcaagtacaagacatcttactattccttttatctccctgttgcttgt
gcattgctgttgtctggtgcaaaattggaaaacttcagtgagctaagggatatactcatt
gaaatgggtatatattttcaagcacaggacgattacttggattgtttcgctaatcctaat
accataggcaagattgggactgacattgaggatcacaagtgttcctggttaattgtgcaa
gctcttggccatgccaatattaaccagatagaagtattacttaaaaactatgggaagaag
gattcaacctctgtttccaaagtgaaaagtacttactcgactcttgatttaaaggacatg
ttctccgagtttgaagatcgagcatacaatcacttggtcacatctatcgaagcccagcat
gaccgtgctgcgcaggagatcctgaaatcgtttctgaagaaaatccacagaaggaaaagg
tag

DBGET integrated database retrieval system