KEGG   Setaria italica (foxtail millet): 105913534Help
Entry
105913534         CDS       T02818                                 

Definition
(RefSeq) glutathione S-transferase
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
sita  Setaria italica (foxtail millet)
Pathway
sita00350  Tyrosine metabolism
sita01100  Metabolic pathways
Module
sita_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:sita00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    105913534
Enzymes [BR:sita01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     105913534
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_C GST_C_3 Big_3
Motif
Other DBs
NCBI-GeneID: 105913534
NCBI-ProteinID: XP_012700287
UniProt: K3Z9L9
Position
III
AA seq 211 aa AA seqDB search
MAAAKPILYSAWISSCSFRVRIALNLKGVDYEYRAVTRTDPDYEKINPIKYVPAFVDGDF
VVSDSLAIILYLEDKYPQHPLLPQDLKKKAINLQIANIVCSSIQPLQCYAVIGLVDGTLG
SDESLQIVRRYIDKGFRAIEKLLEGCDSKYATGDEIQLADVFLAPQIHAGVTRFQIDMSK
YPLLERFYKAYMEIPAVQVAVPEKQPDAPSP
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcaaagcccatcttgtacagcgcgtggatcagctcgtgctccttccgggtc
cggatcgccctcaacctcaaaggtgtggattatgagtacagggctgtgacacggactgat
ccagattatgaaaagatcaatccaatcaagtatgtcccagcatttgtagatggggatttt
gttgtttctgactccctagcaatcatattgtatcttgaagacaagtatcctcaacaccct
cttttgcctcaagatctcaaaaagaaagctattaatctgcagattgcaaatatagtgtgt
tccagcattcaacctcttcaatgttatgctgtaattggtctggttgacggcacgttaggc
tctgatgagagccttcagattgttcggcgttacattgacaagggatttagagcaatcgag
aaacttctggaagggtgtgacagtaaatatgctactggagatgaaatccaattggcggat
gtgtttcttgcaccgcagatccatgccggtgtgacgcgcttccaaattgatatgtcaaag
tatcctcttctggagagattctacaaagcctacatggagatccccgcagttcaggtcgct
gttcctgaaaagcagccagatgcaccatcaccctag

DBGET integrated database retrieval system