KEGG   Setaria italica (foxtail millet): 105913810Help
Entry
105913810         CDS       T02818                                 

Definition
(RefSeq) probable protein S-acyltransferase 2
  KO
K16675  palmitoyltransferase ZDHHC9/14/18 [EC:2.3.1.225]
Organism
sita  Setaria italica (foxtail millet)
Brite
Enzymes [BR:sita01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     105913810
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC
Motif
Other DBs
NCBI-GeneID: 105913810
NCBI-ProteinID: XP_012699189
Position
II
AA seq 190 aa AA seqDB search
MALLLSEWIFLDDVVDRSSAHGILVSASSLILLATATVSLLLAATSDPGIIPRNPVSPSE
EDGTGAARSAPSRFIVVNGVEMRLNFCRACKINRPPRSSHCAVCDNCVDKFDHHCPLISR
CIGLTSHEMEKGRYRSSPNPYDKGALANIRECLFEKLPPPRIDFRAAAEPNLGQAAGGES
EDGELSHSFS
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggcccttctcctttcagaatggattttcttggacgacgtcgtcgatcggtcgtcggcg
cacgggatcctcgtctcagcatcctccctgatcctattggcaaccgcgactgtaagtttg
ctactggctgcaacaagcgaccccggaatcataccaagaaacccggtgtcaccgtctgaa
gaagatggaacaggtgctgccagaagtgctccgagccggttcatcgtcgtcaacggtgtc
gagatgaggctgaacttttgccgggcctgcaagatcaaccgccctccgagaagctcccac
tgcgccgtctgcgacaactgcgtcgacaagtttgatcaccactgccccttgataagccgg
tgcataggactgacgagccatgagatggagaaaggaaggtatcgcagctcgcccaatcct
tacgacaagggagctctggcaaacatcagggagtgcctgtttgagaagctgccgcctcct
agaatcgacttcagagccgcggccgagccaaacctgggtcaggccgccggcggcgagagc
gaggacggcgagctctcccactccttcagctga

DBGET integrated database retrieval system