KEGG   Setaria italica (foxtail millet): 111258244Help
Entry
111258244         CDS       T02818                                 

Definition
(RefSeq) heat shock cognate 70 kDa protein 2-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
sita  Setaria italica (foxtail millet)
Pathway
sita03040  Spliceosome
sita04141  Protein processing in endoplasmic reticulum
sita04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:sita00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    111258244
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    111258244
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111258244
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sita01009]
    111258244
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:sita03041]
    111258244
   03009 Ribosome biogenesis [BR:sita03009]
    111258244
   03110 Chaperones and folding catalysts [BR:sita03110]
    111258244
   04131 Membrane trafficking [BR:sita04131]
    111258244
   03051 Proteasome [BR:sita03051]
    111258244
   03029 Mitochondrial biogenesis [BR:sita03029]
    111258244
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sita04147]
    111258244
Protein phosphatases and associated proteins [BR:sita01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     111258244
Spliceosome [BR:sita03041]
 Complex B
  Other components
   Prp19 complex
    111258244
 Complex C
   Prp19-CDC5 complex
    111258244
Ribosome biogenesis [BR:sita03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    111258244
Chaperones and folding catalysts [BR:sita03110]
 Heat shock proteins
  HSP70 / DNAK
   111258244
Membrane trafficking [BR:sita04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    111258244
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    111258244
Proteasome [BR:sita03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    111258244
Mitochondrial biogenesis [BR:sita03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    111258244
Exosome [BR:sita04147]
 Exosomal proteins
  Proteins found in most exosomes
   111258244
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C StbA Hydantoinase_A DUF1464 DDR
Motif
Other DBs
NCBI-GeneID: 111258244
NCBI-ProteinID: XP_022684990
Position
VIII
AA seq 526 aa AA seqDB search
MADKDDGPAIGIDLGTTYSCVGVWHHGRVVIVTNDQGNLTTPSCVAFTDSERLVGDPAKN
QVARNTSNTVFDAKRLIGRRFGDESVQADIKLWPFRVISGPGDKPMIVVQYKGKERKFSA
EEISSMLLIKMREIAEAYLGTTIKNAVVTIPACSTDSQRQGTRDAGALAGLNIIRIIPEP
TAAAMAYGLDKKATSSGEENVLIFDLGGGTFDVSVLTIEEGIFEVKAVAGDTHLGGEDFD
NKMVNHYVQQFKRKKKKDISDDPRALRRLRTACERAKRTLSSTAQATIEIDCLYEGIDFY
STITRALFEQLNMALFRKCMEPVEKCLRDARMDKSSIHDVVLVGGSSRIPRVQQLLQDFF
NGKELYKSINPDEAVAYGAAVQAAILTGQNYDNENSKIIDLLLLDVTPISLGLETLGGVM
SVLVPRNTTIPIKKEMVLNEKQMILSTDSNQTTIHIQVYEGERTRTRDNNLLGRFEFCVP
SAPSGVPQLTVTFDLDVNGILVVSAEDKTTGKKKKITVNKRFYITK
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggccgacaaggacgatggtcctgccatcgggatcgacctggggacgacctactcctgc
gtcggagtctggcatcacggccgcgtcgtgatcgtcaccaacgaccaaggcaacctaacc
acaccatcctgcgtcgccttcaccgactccgagcgcctcgtcggggatcccgccaagaac
caggtcgccaggaacacaagcaatacagtcttcgatgccaagcggctcattggtaggaga
ttcggtgatgaatctgtccaggctgacattaagctctggcccttcagagtcatttctgga
cctggagacaagcctatgattgttgttcaatacaagggcaaggagaggaagttttctgct
gaagagatatcctcaatgcttctcatcaaaatgagggagattgcagaagcctaccttggc
accaccatcaagaacgctgtcgtcactatccctgcatgctccaccgactcgcagaggcag
ggaaccagggatgccggagcgctcgctggtctcaacattatccgtatcatccctgagccg
actgctgctgccatggcttatggtcttgacaagaaggccactagtagcggtgaggagaat
gttctcatcttcgaccttggtggtggtacctttgatgtctctgttcttaccatcgaggag
ggaatctttgaggtcaaggccgtagctggtgacactcaccttggaggtgaggactttgac
aacaagatggtcaaccactatgttcagcagttcaagagaaagaagaagaaggacatcagt
gatgaccccagggctctcaggaggcttaggacagcctgcgagagggccaagaggaccctc
tcctcaactgcgcaagccaccattgagatcgactgcctgtatgaaggaatcgatttctac
tcaaccatcacccgtgccttgttcgagcagctcaacatggctctcttcaggaagtgcatg
gagcctgtggagaagtgcctcagggatgctagaatggacaagagctccattcatgatgtt
gtgcttgttggtggctcctctagaattccaagggttcagcagcttctccaggactttttc
aatgggaaggagctttacaagagcatcaaccctgacgaggctgttgcctacggagctgct
gtccaggctgccatcttgacaggacagaactatgacaatgagaattcaaagattatcgac
ctccttttgttggatgttactcctatttctcttggtttggagacactaggtggtgtcatg
tctgtgctggttccaagaaacaccaccatccccatcaaaaaggagatggtattaaatgaa
aaacagatgatcttatctaccgactccaaccagactaccatccatatccaggtctacgag
ggtgagaggaccagaactcgtgacaacaacctgctgggcaggttcgagttctgcgttcct
tctgcacccagcggtgttccacagctcactgttaccttcgatctggacgtcaacggtatc
ctggtcgtatctgctgaggacaaaaccactggcaagaagaagaagataaccgtcaacaag
agattttatattacaaagtga

DBGET integrated database retrieval system