KEGG   Streptococcus intermedius C270: SII_0230Help
Entry
SII_0230          CDS       T02831                                 

Gene name
mvaS
Definition
(GenBank) hydroxymethylglutaryl-CoA synthase
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
siu  Streptococcus intermedius C270
Pathway
siu00280  Valine, leucine and isoleucine degradation
siu00650  Butanoate metabolism
siu00900  Terpenoid backbone biosynthesis
siu01100  Metabolic pathways
siu01110  Biosynthesis of secondary metabolites
siu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:siu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SII_0230 (mvaS)
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    SII_0230 (mvaS)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SII_0230 (mvaS)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SII_0230 (mvaS)
Enzymes [BR:siu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     SII_0230 (mvaS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG_CoA_synt_C HMG_CoA_synt_N ACP_syn_III Chal_sti_synt_N ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AGU77435
Position
complement(228565..229737)
Genome map
AA seq 390 aa AA seqDB search
MNIGIDKIGFATANYVLKLADLAEARGIVPDKLSKGLLLKELSIAPITEDIVTMGASAAE
SILTAKDKNEIDMVIVASESGIDQSKASAVFVHGLLGVQPFARSLEMKEACYSATAALDY
ARLHVEKHPNSKVLVIASDIAKYGVDTPGEPTQGAGAVAMLITNNPRILIFNEDNVAQTR
DIMDFWRPNYSTTPFVNGMYSTQQYLDSLKTTWVEYQKRNQVSLKDFAAICFHLPYPKLA
LKGLKKIMDKSLSLEQQEQLQANFHQSILYSQKVGNIYTGSLFLGLLSLLENSSTLKTGD
RIALFSYGSGAVSEIFSGQLVAGFKQRLQTNRIEMLNNRTPLSIPDYEKIFFEEAQLDQN
GSASFMNYENQNFALAEIVEHQRRYIKVEK
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaatattggaattgataaaattggctttgcgacagccaattacgtattaaaattagca
gatttagcagaagcacgcggcattgtcccagataaactaagtaaagggctcctattaaaa
gaactcagtatcgctcctattactgaagatatcgtaactatgggcgcgagtgctgcagag
tctattttaacagcaaaagataaaaatgagattgatatggttatcgtagccagcgaatct
ggaattgaccaaagtaaggcttctgctgtttttgttcatggcctgctaggggttcagcca
tttgcacgtagtttagaaatgaaagaagcgtgctacagcgctactgctgcactagattat
gcgaggttacatgtcgaaaaacatcccaactcaaaggtgttggtcattgcaagcgatatt
gctaaatacggtgtcgatacccctggggaaccaacccaaggggctggagcagtcgctatg
ctcatcacaaataatccacgaatcctcatttttaatgaagataatgttgctcaaacacga
gatattatggacttttggcggccaaattattctacaacgccgtttgtcaatggcatgtat
tccacacaacagtatttagatagcctaaaaacaacttgggtggaatatcaaaaacgcaat
caagtatctttaaaagatttcgcagctatttgtttccacttgccttatcctaagctagct
ttaaaaggcttgaaaaaaattatggataaaagcttgtcccttgaacaacaagagcaacta
caagcaaatttccatcaatctattctttacagtcaaaaagtaggcaacatctacacaggc
tctctctttttaggtctcctttctctacttgaaaatagctcaacacttaaaacaggtgac
cggattgcgctctttagttatggtagcggagctgtatcagaaatctttagcggtcagctt
gtagcaggctttaagcaacgccttcaaaccaatcgtatagaaatgctcaacaatcgcacg
ccactaagcataccagattatgagaaaatattttttgaagaagctcaactagatcaaaat
ggttctgctagctttatgaactatgaaaatcagaactttgctttagcagaaattgttgag
caccaacgtagatacatcaaggtggaaaaataa

DBGET integrated database retrieval system