KEGG   Streptococcus intermedius C270: SII_1455Help
Entry
SII_1455          CDS       T02831                                 

Definition
(GenBank) putative dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
siu  Streptococcus intermedius C270
Pathway
siu00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:siu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SII_1455
Enzymes [BR:siu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     SII_1455
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     SII_1455
    1.1.1.-  
     SII_1455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N ADH_N_assoc 2-Hacid_dh_C AdoHcyase_NAD
Motif
Other DBs
NCBI-ProteinID: AGU78621
Position
complement(1515150..1516196)
Genome map
AA seq 348 aa AA seqDB search
MAKMNAARWYGAKDVRIEEVDVPEVKPHQVKIAVKFTGICGTDLHEYLDGPIFIPTETEH
VYSGQKAPVTLGHEFAGEIVEVGSAVTRVKVGDRVTVEPILAKHNLIGDYNLDPNLNFVG
LAADGGFAKYCVLDGDLVHKVPDSLSYEQAALTEPAAVAVYAVRQSALKAGDTAVVFGLG
PIGLLIVEALRAAGASKIYTVELSPERQAKAEELGAIVVRPEEGEDTVAAVQRLTGGGAD
VSYEVTGVPVVLGQALAAVHKAGECMVVSIWEREASINPNEFAIQEKSLKGIIAYRHIFP
KVLELMEQGYFSADKLVTKKIKLEDIVQEGFIELTQDKAQIKILVSPE
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaatgaatgctgcgcgttggtatggcgccaaagatgtccgcattgaagaagtg
gatgtaccggaagtcaaaccgcatcaggtcaagattgcggttaagttcacaggaatctgt
ggaactgatttgcatgaatatctggatggacctatttttattccgacagaaacagagcat
gtctactctgggcagaaggctcctgtaaccttgggacatgagtttgctggagaaattgtt
gaggttggcagtgccgtgacacgggttaaggttggtgaccgagtgacagttgagccgatt
ttagccaagcataatcttatcggggattacaatctggatcccaatctaaactttgtcggc
ttggcggcagatggtggttttgccaaatactgtgttttggatggggatcttgttcataaa
gttccagacagccttagctatgagcaggcagccttgacagaacctgctgctgtggctgtt
tatgcagtccgtcagtcagctcttaaggcaggtgataccgcagtcgttttcggtttagga
ccaatcgggctcttgattgttgaagctttgcgagcagccggtgcctctaagatttatact
gttgaattatctccagagcgccaagcaaaggcagaggagcttggggcgattgttgtgcga
ccagaagaaggcgaggatacagtggctgctgttcagcgcttgactggtggtggggcagat
gtatcttatgaagtaactggggtaccagttgtattgggacaagctttggctgctgtccac
aaggctggtgaatgtatggtggtttctatctgggaacgtgaagccagtatcaatcccaat
gaatttgcgattcaagaaaaatcgctcaagggaattatcgcctatcggcatatttttcct
aaggtgctggagcttatggagcaggggtatttctctgctgacaagcttgtgaccaagaag
attaagctagaggatattgtgcaggaaggttttatcgaactgacccaggacaaggcacag
attaaaattttggtgtcaccagaataa

DBGET integrated database retrieval system