KEGG   Streptococcus intermedius C270: SII_1534Help
Entry
SII_1534          CDS       T02831                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
siu  Streptococcus intermedius C270
Pathway
siu00480  Glutathione metabolism
siu00590  Arachidonic acid metabolism
siu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:siu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    SII_1534
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SII_1534
Enzymes [BR:siu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SII_1534
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AGU78698
Position
1607470..1607946
Genome map
AA seq 158 aa AA seqDB search
MTKIYDFSIFDQNNRSISLEIYKGNVLLIVNTATGCGLTPQYKGLQHLYTRYQNQGFEIL
DFPCNQFMGQAPGTAEEINRFCSLHYQTTFPRFAKVKVNGKEADPLYIWLKEQQAGPLGK
RIEWNFTKFLINREGQVVKRFSSKAEPKEIEESLQKLL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaatatatgatttttccattttcgatcagaataatcgatctatctccctagaa
atttataaagggaatgttctgcttattgtcaatactgcaacaggttgtggcctgaccccc
caatataagggactacaacacctctacacccgctatcaaaaccagggttttgaaatcctc
gactttccttgtaatcaatttatggggcaggcaccaggtacagcagaagaaatcaatcgt
ttttgcagcctccactaccaaactacttttccacgttttgctaaagttaaagtcaatggt
aaggaagcagatcctctctatatctggctaaaagaacaacaagctggccccctcggaaaa
agaatcgaatggaattttactaaattcttaataaaccgagaagggcaagttgtgaaacga
ttttcatctaaagcagaacctaaagagattgaggaaagtttacaaaagctattataa

DBGET integrated database retrieval system