KEGG   Solibacillus silvestris StLB046: SSIL_0037Help
Entry
SSIL_0037         CDS       T02162                                 

Gene name
ipk
Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol 2-phosphate synthase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
siv  Solibacillus silvestris StLB046
Pathway
siv00900  Terpenoid backbone biosynthesis
siv01100  Metabolic pathways
siv01110  Biosynthesis of secondary metabolites
siv01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:siv00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SSIL_0037 (ipk)
Enzymes [BR:siv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     SSIL_0037 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: BAK14460
UniProt: F2F196
Position
complement(48752..49618)
Genome map
AA seq 288 aa AA seqDB search
MLYVKAPAKINLTLDVLYKRPDQYHEVEMIMTTVDLADRIGLESRADGQIKIVSTDNFVP
DDQRNFAYQAAELLKNTYGIKEGVTISIEKQIPIAAGLAGGSSDAAATLRGLNELWNLNL
TMDELAEHGAKIGSDVSFCVYGGTALATGRGEKIKELSAPPTCWVVLAKPKIGVSTADVY
GGLNIEGLQHPNTSEMIKAIETEDYELMCNSLGNVLETVTFNLHPEVITIKEQMQRFGAD
AVLMSGSGPTVFGLVENEARVSRIYNGLRGFCEEVYVVRMLGERNPLA
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgttatacgtaaaagcacccgcaaaaattaacttaacactcgatgtgctttataaacgt
ccagatcaatatcatgaagtcgaaatgattatgacaacggtcgacttagccgatcgaatt
ggactagaatcacgagcagatggccaaattaaaattgtttcgacagataattttgttccg
gatgatcagcggaattttgcttaccaggcagcagagcttttaaaaaatacatacggtatt
aaagaaggcgtaactatttcaattgagaagcaaattcctatagcggcgggtctagcgggt
ggaagcagcgatgcagcggccacattgcgcggtttaaatgagctttggaatctaaattta
acaatggacgagctggcggaacatggagcgaaaattggttctgatgtatctttctgcgtt
tatggcggtacagcattggctactgggcgcggagaaaagattaaagaactatcggcacct
ccaacttgttgggttgttttggccaagccgaaaattggcgtatcgacagctgatgtatac
ggtgggctgaatattgaaggactacaacatccaaacacgagtgaaatgataaaggcgatt
gaaacagaagattatgagctaatgtgcaattcacttggaaatgttttggaaactgtaaca
tttaatcttcatccggaagttattacaattaaagagcaaatgcaacgttttggtgctgac
gcagtacttatgagcggcagtggtccgacagtatttgggctggtggaaaatgaagcacgt
gtcagcagaatctacaatggattacgtggtttttgtgaggaagtttatgtagtacgtatg
ttgggggaacgaaatccacttgcataa

DBGET integrated database retrieval system