KEGG   Solibacillus silvestris StLB046: SSIL_0211Help
Entry
SSIL_0211         CDS       T02162                                 

Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
siv  Solibacillus silvestris StLB046
Pathway
siv00620  Pyruvate metabolism
siv00630  Glyoxylate and dicarboxylate metabolism
siv01100  Metabolic pathways
siv01110  Biosynthesis of secondary metabolites
siv01120  Microbial metabolism in diverse environments
siv01200  Carbon metabolism
Module
siv_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:siv00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SSIL_0211
   00630 Glyoxylate and dicarboxylate metabolism
    SSIL_0211
Enzymes [BR:siv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     SSIL_0211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: BAK14634
UniProt: F2F4A0
Position
251112..253289
Genome map
AA seq 725 aa AA seqDB search
MTNYVQVGNLQVTEVLFQFINEQVLPNSGVEQTAFWDGFDKLVHELAPENKALLAQRDAL
QVQINEWHKGNKGNFQFADYKAFLEEIGYVEPKAEDFQVETENVDAEIAYQAGPQLVVPV
SNARYAINAANARWGSFYDALYGTDVISDEDGTEAGKGYNPIRGNKVIDYAKKFLDQAAP
LKAASHKDAITYKIAESKLVITLVNGETTTLAEPEKLVGYQGTTEQPTAILLKNNDLHIE
IQIDRNHPIGKDDAAGVKDIYLESAITTIMDCEDSVAAVDAEDKVEVYANWLGLMKGDLT
ATFAKGSKTVTRTLNPDRVYTGVNGDTVTLNGRSLMFIRNVGHLMTNPAILDQDGSEVPE
GIMDGVVTSLIAKHEVIGNGSYKNSQKGSIYIVKPKMHGSKEVAFANKLFERVEDLIGLE
RFTLKIGVMDEERRTSLNLKACIREVKNRIVFINTGFLDRTGDEIHTSMEAGPMIRKGEM
KTSTWLTSYEKSNVIVGLNAGLQGRAQIGKGMWAMPDLMAEMIEQKINHPKAGANTAWVP
SPTAATLHATHYHEVNVKDVQKGIVSSEDLQDAILEIPVAANTDWTREEIQHELDNNAQG
ILGYVVRWVEHGVGCSKVPDINNIGLMEDRATLRISSQHVANWLHHGICTKEQVEESLKR
MAKIVDEQNADDPEYLPMSANYEDSVAFQAASELIFKGYDQPNGYTEPILHKKRIEAKAK
QKVNA
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
gtgacaaattatgtgcaagtggggaacttacaagtaacggaagtattatttcagtttatt
aatgagcaagtattaccaaacagtggagtagagcaaacggcattttgggatggcttcgat
aagctggttcatgagttggcacctgaaaataaagcattgcttgctcaacgtgatgcattg
caagtacaaattaatgagtggcataaaggaaataaggggaatttccaatttgccgactat
aaggcgtttttagaagaaatcggttatgtagaaccaaaagcagaagacttccaagtggaa
acagaaaacgtagatgcagaaattgcatatcaggcaggtccgcaattagtagtacctgtc
agcaatgcacgctatgcaattaatgcagcaaatgcacgttggggaagtttctatgatgca
ctatacggtacagatgtcattagtgacgaagacggtactgaagcaggcaagggttataat
ccgattcgtggaaacaaagtaatcgattatgcgaaaaagtttttagatcaagcagctcct
ttaaaagcagcttcacataaagatgcaataacttataaaattgcagaaagtaaattagta
attacgctcgtaaatggtgaaacgacgacattggcagagccggaaaagttagtaggctac
caaggaacaacagaacagccgactgcgattttactgaaaaataatgatttgcacattgaa
attcaaattgaccgaaatcacccaattggaaaagatgatgcagctggagtaaaagatatt
tatttagagtctgctattacgacaattatggactgcgaggactcggtagcagcagtagat
gcagaagataaagtggaagtttatgcaaactggttagggctaatgaaaggcgacttaacg
gcaacttttgcaaaaggatcgaaaacggtaacacgtacattaaatcctgaccgagtatat
acgggagttaatggtgatacggtaacattaaatggccgctctttaatgtttattcgcaat
gtaggtcacttaatgacaaatccggcaattctagatcaagatggcagcgaagtgcctgaa
ggaattatggatggtgtcgtaacgagcttaatagcgaagcatgaagtaattggcaatggt
tcgtataaaaattcgcaaaaaggctctatctatattgtaaaaccaaaaatgcacggctca
aaggaagtagcgtttgcaaataaactatttgagcgtgtagaagatttaatcggattggaa
cgattcacgttaaagattggtgttatggatgaggaacgacgtacatcacttaacttaaaa
gcatgtatacgtgaagtgaagaatcgtattgtctttattaatacaggattcctggatcgt
acaggagatgaaatccatacatcaatggaagcgggcccaatgattcgcaaaggcgaaatg
aaaacatcaacatggctcacatcttatgaaaaatccaatgtcatcgttgggttaaatgca
ggcttgcaaggccgtgcacaaattggaaaagggatgtgggctatgccggacttaatggca
gagatgattgagcagaaaatcaatcatccaaaagcaggggcaaatactgcttgggtacca
tcgccgacagccgcaacattacatgcaacacattatcatgaagtaaatgtaaaagacgtt
caaaaaggtattgtgtcatcggaagatttacaagatgcgattttggaaatcccggtagcg
gcaaatacagattggacacgtgaagaaattcaacatgagcttgataataatgcacaagga
atccttggctacgtagtccgttgggtggaacatggtgtgggctgttcaaaagtgccggat
attaataatatcggcttaatggaagaccgcgcaacgttgcgtatttcaagtcagcatgtt
gcaaactggctgcatcacggtatttgtacgaaagaacaagtagaggaatcattgaaacgt
atggcaaaaattgtagatgagcaaaatgcagacgatcccgaatatttaccaatgtcagca
aactacgaggattctgtagctttccaagcagcaagtgagcttatatttaaaggctatgat
caaccaaatggttacacagagccgattttacacaaaaagcgtattgaagcgaaagcaaaa
caaaaagtaaacgcataa

DBGET integrated database retrieval system