KEGG   Solibacillus silvestris StLB046: SSIL_0775Help
Entry
SSIL_0775         CDS       T02162                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
siv  Solibacillus silvestris StLB046
Pathway
siv00010  Glycolysis / Gluconeogenesis
siv00051  Fructose and mannose metabolism
siv00562  Inositol phosphate metabolism
siv01100  Metabolic pathways
siv01110  Biosynthesis of secondary metabolites
siv01120  Microbial metabolism in diverse environments
siv01130  Biosynthesis of antibiotics
siv01200  Carbon metabolism
siv01230  Biosynthesis of amino acids
Module
siv_M00002  Glycolysis, core module involving three-carbon compounds
siv_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:siv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSIL_0775
   00051 Fructose and mannose metabolism
    SSIL_0775
   00562 Inositol phosphate metabolism
    SSIL_0775
Enzymes [BR:siv01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SSIL_0775
Exosome [BR:siv04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SSIL_0775
  Exosomal proteins of bladder cancer cells
   SSIL_0775
  Exosomal proteins of melanoma cells
   SSIL_0775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM DrsE
Motif
Other DBs
NCBI-ProteinID: BAK15198
UniProt: F2F088
Position
850777..851538
Genome map
AA seq 253 aa AA seqDB search
MRKPIIAGNWKMYKSFDEAVDFIEEIQQEIPSTDKVDAVICAPALYLPTLVVGAEDSSLA
IGAQNMHFEDEGAFTGEISPKMLSNVNVDYVILGHSERRELFNETDEAINKKVRAALNYG
IVPIICCGETLEEREAGQTEAKVARQITKALKDFAPIEVEHMVIAYEPIWAIGTGKTATA
EDANTVCCAIRLAVETLYGKDTAEKVRIQYGGSVKPENIEELLSQEHIDGALVGGASLQP
ASFMKLLEAAANA
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaccgatcatagcaggaaactggaaaatgtataagtcctttgatgaggcagtt
gattttatcgaagaaatccaacaagagattccttctacggataaagttgatgcggtcatc
tgtgcacctgcgttatatttaccgacacttgtcgtaggggcagaagattcaagcctggca
attggcgcgcaaaacatgcactttgaagacgaaggagcatttacaggcgagatcagcccg
aaaatgctttcgaatgtcaatgtcgattatgtcattttagggcattcggagcgtcgtgag
ctattcaatgaaacagacgaagcgatcaacaaaaaagtccgtgctgctcttaattacggt
attgtaccgattatttgctgcggcgaaacattggaagagcgtgaagcgggtcaaaccgaa
gcaaaagtagcacgccaaattacaaaagcgttaaaagactttgctccaattgaagttgag
catatggtcattgcgtatgaaccaatctgggcaatcggaacagggaaaacagctactgcg
gaagatgcgaatacagtatgctgtgcaatccgtctggcggttgaaacattatacggaaaa
gatacagctgaaaaagtgcgcattcaatacggtggcagtgtaaagcctgagaacattgaa
gagcttttatcacaagaacatatcgatggcgcattagtaggaggagcaagcctacaacca
gcatcattcatgaaattattggaggcggcagcaaatgcctaa

DBGET integrated database retrieval system