KEGG   Solibacillus silvestris StLB046: SSIL_2107Help
Entry
SSIL_2107         CDS       T02162                                 

Definition
(GenBank) pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
siv  Solibacillus silvestris StLB046
Pathway
siv00020  Citrate cycle (TCA cycle)
siv00310  Lysine degradation
siv01100  Metabolic pathways
siv01110  Biosynthesis of secondary metabolites
siv01120  Microbial metabolism in diverse environments
siv01130  Biosynthesis of antibiotics
siv01200  Carbon metabolism
Module
siv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
siv_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:siv00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SSIL_2107
  Amino acid metabolism
   00310 Lysine degradation
    SSIL_2107
Enzymes [BR:siv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SSIL_2107
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N PYNP_C
Motif
Other DBs
NCBI-ProteinID: BAK16530
UniProt: F2F4W5
Position
2177484..2178737
Genome map
AA seq 417 aa AA seqDB search
MAEIKVPELAESITEGTIAQWVKKVGDRVEKGEFIVELETDKVNAEIISEEAGVLKQILA
EEGDTVLVGQVIAVVEAGEGAAPAPAAKEEAPAAAPAKEEAPKAAAPAPVAVEETSGERV
IASPAARKLAREKGIDLAAISPVDPQGRVRVQDVAAHGTAPAAPAAAPAPAAGNGPMIFT
PAADTDRVTVEKMSRRRQTIAKRLLEVKQSTAMLTTFNEIDMTNIMALRKRKQDEFVKAN
DIKLGFMSFFTKAVVAALKKYPYVNAQINGDEIHLNNFFDIGIAVSTEEGLVVPVVRDAN
AKNFAEIEKNIAELAGKARDKKLGLNDMAGGSFTITNGGVFGSLMSTPIMNGTQAGILGM
HSIVNRPVAVNGEVQIRPMMYVALSYDHRIIDGKDSVGFLKTVKEMIENPEDLLLNS
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
gtggctgaaattaaagtccctgaattagcagaatcaattactgaaggaacaattgcccaa
tgggtgaaaaaagttggagatcgcgtagaaaaaggcgaattcatcgttgagttagaaact
gataaagttaatgctgaaattatctctgaagaagcaggcgttttaaaacaaattttagct
gaagaaggcgatactgtattagttggacaagtaatcgcagtagttgaagcaggcgaaggc
gcagcaccagcaccagctgcaaaagaagaagctccagcagcagctccagcaaaagaagaa
gctcctaaagcagcagcaccagcaccagttgcagttgaagaaacttcaggtgagcgtgta
atcgcttcaccagcagcacgtaaattagctcgtgaaaaaggtatcgacttagcagcaatt
tcaccagttgatccacaaggtcgtgtacgtgttcaagacgttgcagcacatggtacagct
cctgcggctccagcagcagctccagctccagcagcaggcaatggtccaatgatctttaca
ccagcagctgatacagaccgtgtaacagttgaaaaaatgagccgtcgtcgtcaaacaatt
gcaaaacgtttattagaagttaaacaatcaactgcaatgttaactactttcaatgaaatt
gatatgacgaacattatggcattacgtaagcgtaaacaagatgagttcgtgaaagctaac
gatattaaattaggcttcatgtcattcttcacaaaagctgtagtagcagcattaaagaaa
tatccatatgtaaatgcacaaattaacggtgatgaaattcacttaaacaacttcttcgat
atcggtattgctgtatcaacagaagaaggtttagtagtaccagtagttcgtgatgcaaat
gcgaaaaactttgctgaaatcgagaaaaacattgcggaattagctggtaaagcacgcgac
aaaaaattaggcttaaacgacatggctggcggatcattcacaatcactaacggtggtgta
ttcggttcattaatgtctacaccgatcatgaacggtactcaagctggtattttaggtatg
cactcaatcgtaaaccgtccagtagctgttaatggtgaagttcaaattcgtccaatgatg
tatgtagcattatcttatgaccaccgtatcatcgatggtaaagattctgttggcttctta
aaaacagttaaagaaatgatcgaaaatccagaagatttattattaaattcttaa

DBGET integrated database retrieval system