KEGG   Solibacillus silvestris StLB046: SSIL_2462Help
Entry
SSIL_2462         CDS       T02162                                 

Definition
(GenBank) dehydrogenase with different specificities
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
siv  Solibacillus silvestris StLB046
Pathway
siv00072  Synthesis and degradation of ketone bodies
siv00650  Butanoate metabolism
siv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:siv00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    SSIL_2462
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    SSIL_2462
Enzymes [BR:siv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     SSIL_2462
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Polysacc_synt_2 Epimerase 3HCDH_N Sacchrp_dh_NADP DFP Methyltransf_31 3Beta_HSD UPF0146
Motif
Other DBs
NCBI-ProteinID: BAK16885
UniProt: F2F1M2
Position
2509994..2510761
Genome map
AA seq 255 aa AA seqDB search
MVQNKVVFITGAAQGIGFEIAKEFYTKGATVVLTDINEEKVKEAASSLGERAIGLKCDVT
NEEEIIAAINETVQKFGRIDILINNAGMQHVAMIEDFPTERFELLIKIMLTAPFVLTKHV
LPHMRKQKFGRIINMASINGLVGFAGKAAYNSAKHGVIGLTKVAALETASDGITVNAICP
GYVDTPLVRNQLQDLAATRNIPLENVLEEVIYPLVPQKRLLDVKEISDLSLFISSEGAKG
MTGQAIVLDGGYTVQ
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
gtggtacaaaataaagtggtattcattactggtgcagcacaaggtataggatttgagatt
gcgaaagagttttatacaaaaggtgctactgtcgtgctaacagatataaatgaagaaaaa
gtgaaagaggcagcaagcagccttggagaacgagcaattggacttaaatgtgatgtaaca
aatgaagaagaaattatagcagcaattaatgaaacggtacagaagtttggtcgaatcgat
atacttataaacaatgctggtatgcaacatgttgcaatgattgaagattttccgacagag
cgtttcgaactgttaataaaaataatgttaactgctccatttgtattaactaagcatgtg
ttaccgcatatgagaaaacaaaaatttggccgtattattaatatggcttctattaacgga
ctggttggatttgcaggaaaagcagcctataattctgccaaacatggtgttattggtctc
acaaaagttgcggcacttgaaactgcatcagatggcataacggttaacgctatttgtcca
ggctatgtagatacaccacttgttcgaaatcaattgcaagacttagcagcaacacgcaat
atacctctcgaaaacgtattggaagaagtgatttacccactcgttcctcaaaaaagatta
cttgatgtaaaagaaatctctgatttgtctctatttatctcaagcgagggagcaaaagga
atgactggccaggctatcgttttagatggcgggtacacagtgcaataa

DBGET integrated database retrieval system