KEGG   Solibacillus silvestris StLB046: SSIL_2631Help
Entry
SSIL_2631         CDS       T02162                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
siv  Solibacillus silvestris StLB046
Pathway
siv00071  Fatty acid degradation
siv00072  Synthesis and degradation of ketone bodies
siv00280  Valine, leucine and isoleucine degradation
siv00310  Lysine degradation
siv00362  Benzoate degradation
siv00380  Tryptophan metabolism
siv00620  Pyruvate metabolism
siv00630  Glyoxylate and dicarboxylate metabolism
siv00640  Propanoate metabolism
siv00650  Butanoate metabolism
siv00900  Terpenoid backbone biosynthesis
siv01100  Metabolic pathways
siv01110  Biosynthesis of secondary metabolites
siv01120  Microbial metabolism in diverse environments
siv01130  Biosynthesis of antibiotics
siv01200  Carbon metabolism
siv01212  Fatty acid metabolism
siv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:siv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SSIL_2631
   00630 Glyoxylate and dicarboxylate metabolism
    SSIL_2631
   00640 Propanoate metabolism
    SSIL_2631
   00650 Butanoate metabolism
    SSIL_2631
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SSIL_2631
   00072 Synthesis and degradation of ketone bodies
    SSIL_2631
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SSIL_2631
   00310 Lysine degradation
    SSIL_2631
   00380 Tryptophan metabolism
    SSIL_2631
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SSIL_2631
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SSIL_2631
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SSIL_2631
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:siv04147]
    SSIL_2631
Enzymes [BR:siv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SSIL_2631
Exosome [BR:siv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SSIL_2631
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: BAK17054
UniProt: F2F5X1
Position
complement(2682497..2683690)
Genome map
AA seq 397 aa AA seqDB search
MKNAVIIDSVRTAVGRMGETLKNVEVDYLAAKVLDEITVRTGIGKDKIDEVIIGQAKQST
DSPNLARLALLRAGFPIEITGYTVHRQCGSGLQAMNSGAQQIMCGLSDIIIAGGAESMST
APYYLRNVRYGYGAGNGEILDSNTESQPRAQPIETYGALTMGMTAENLAVKYAISRSEQD
EFAIRSQENAKRAIETGLFKDQIVPFEVKTKKGMVEFKVDEHPRETTFEKLSQLKPVFKE
NGTVTAGNTSGRNDGAGVIMLMSEEAAAQYDKKPKAKIIAQAVSGVSPEIMGIGPAPATR
KALQLADLTLDQIGLIELNEAFAAQSLAVIKELGMDINRVNVNGGAIALGHPIGGTGGVL
MTKLLHEMERRGEKYGLVTFCIGGGLGITTIVENMQL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgccgtaattatagactctgtacgtacagcagttggtcgtatgggcgaaaca
ttaaaaaatgtagaggtagattatcttgcggcaaaagtgttggacgaaattactgttcgt
accggaattggtaaggataaaatcgatgaagtcattatcggacaagcaaagcaaagtact
gattcgcctaatctagcccgcttagcccttttacgtgcaggttttccgattgaaattacc
ggctatacagttcaccggcaatgcggttcaggtctgcaggcaatgaatagcggtgctcag
caaatcatgtgtgggctttcggatattattattgcgggtggagctgaaagcatgagcaca
gccccatactatttgcggaatgtccgttacggttacggtgctggaaacggtgaaattctc
gattcgaacactgaaagtcaaccacgtgcccagccaattgaaacatatggtgcattaaca
atgggaatgactgctgaaaacttggctgtaaaatacgccatttcccgaagtgaacaagat
gagtttgccataaggagccaggagaatgcaaaaagagccatcgaaacgggattgttcaag
gatcaaatcgtcccatttgaagtgaagacgaaaaaaggaatggtcgaatttaaagtagac
gaacatccgagggaaacaacattcgaaaaattatctcaattaaaaccggtttttaaagaa
aacggtacagttactgccgggaatacaagcggtcgtaatgatggtgcgggtgtgattatg
cttatgtcggaagaagcagctgcacagtatgataaaaaacctaaggcgaaaattattgcg
caagctgtatcaggagtttcaccggaaattatgggaattggccctgccccggcaactaga
aaagcattgcaattagcggatttaacacttgatcaaatcggtttaatagaattaaatgaa
gcctttgcagctcaatccttggccgtcatcaaggaacttggcatggatataaaccgagta
aatgtaaatgggggcgcaatcgcacttggtcatccgattggcggcacaggtggtgtatta
atgacgaagctgcttcatgaaatggaaagacgtggagaaaaatacggtctagttacattc
tgtattggcggcggtcttggtattacaacaattgttgaaaatatgcagttgtag

DBGET integrated database retrieval system