KEGG   Solibacillus silvestris StLB046: SSIL_2859Help
Entry
SSIL_2859         CDS       T02162                                 

Definition
(GenBank) glycyl-tRNA synthetase
  KO
K01880  glycyl-tRNA synthetase [EC:6.1.1.14]
Organism
siv  Solibacillus silvestris StLB046
Pathway
siv00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:siv00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SSIL_2859
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:siv01007]
    SSIL_2859
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:siv03016]
    SSIL_2859
   03029 Mitochondrial biogenesis [BR:siv03029]
    SSIL_2859
Enzymes [BR:siv01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     SSIL_2859
Amino acid related enzymes [BR:siv01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   SSIL_2859
Transfer RNA biogenesis [BR:siv03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    SSIL_2859
Mitochondrial biogenesis [BR:siv03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    SSIL_2859
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HGTP_anticodon tRNA-synt_2b Zn-ribbon_8
Motif
Other DBs
NCBI-ProteinID: BAK17282
UniProt: F2F1U9
Position
2912084..2913472
Genome map
AA seq 462 aa AA seqDB search
MAEKSMETIVSLAKHRGFVFPGSDIYGGLANTWDYGPLGVELKNNVKKAWWLKFVQESEH
NVGLDAAILMNPKAWVASGHVGNFNDPMIDCKACKARHRADKLIEDASLTKTGKEIIVDG
MTFDQMKEKMEELEVACPDCGKIDFTDIRQFNLMFKTHQGVTESSSNEIYLRPETAQGIF
VNFKNVQRSMRKKTPFGIAQIGKSFRNEITPGNFTFRTREFEQMELEFFCKPGEDLEWHS
YWKEFCKNWLLALGMKEDSMRLRDHEDDELSHYSNATTDIEFRFPFGWGELWGIADRTDY
DLKQHMEHSGEDFTYIDPVSNERYVPYCIEPSLGADRVTLAFLCDAYEEEQLEGDDTRTV
LRFHPALAPFKAAVLPLSKKLSEEAGDVWADLRKAFPVDYDESQSIGKRYRRQDEIGTPF
CITYDFDSKEDGQVTVRHRDSMEQIRMPIAEVKAYIEKHLQF
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaaatcaatggagacaattgtatcattagcaaaacaccgcggattcgtattt
cctggatctgatatttatggtggtttagcaaacacttgggattacggtccacttggtgta
gaacttaaaaacaacgtaaaaaaagcttggtggctaaaattcgttcaggaatcagaacat
aacgtaggcttggatgctgcaattttgatgaatcctaaagcatgggttgcatctggtcac
gtaggtaacttcaacgacccgatgatcgactgtaaagcatgtaaagcgcgtcaccgtgca
gataaattgattgaagatgcttctttaacaaaaacaggcaaagaaattatcgttgacggt
atgactttcgatcaaatgaaagaaaaaatggaagagcttgaagtagcttgtcctgactgc
ggaaaaatcgacttcacagatatccgccaattcaacttaatgttcaaaacgcaccaaggt
gtaactgaatcttcttcaaacgaaatctacctgcgtcctgaaacagcacaaggtattttc
gtaaactttaaaaacgttcagcgttcaatgcgtaaaaaaacaccattcggtattgcacaa
atcggtaaatctttccgaaatgagatcacaccaggtaacttcacattccgtactcgtgaa
ttcgaacaaatggaacttgaattcttctgtaaaccgggtgaagatcttgaatggcactca
tactggaaagagttctgtaaaaactggcttcttgcattaggtatgaaagaagattcaatg
cgtttacgtgaccatgaagatgatgagctttcacactattcaaatgccacaacagatatc
gaattccgcttcccattcggatggggcgaactatggggtatcgcagaccgtacagattac
gacttaaagcagcatatggaacattcaggtgaagatttcacttacatcgatcctgtttca
aatgagcgctatgtaccatactgcatcgagccatcattaggtgcagaccgtgtaacattg
gcattcttatgtgatgcatatgaagaagagcaattagagggcgatgatacgcgtacagta
ttacgcttccaccctgctctagctccatttaaagcagcagtattgccactttctaaaaag
ttatctgaagaagctggcgacgtttgggctgacttgcgtaaagcattcccggttgattac
gatgagtcacaatcgatcggtaaacgttaccgccgccaagatgaaatcggtacaccattc
tgtattacgtacgatttcgattcaaaagaagacggtcaagtaacagttcgtcaccgcgat
tcaatggaacaaatccgtatgccgatcgctgaagtaaaagcttatatcgaaaaacattta
caattctaa

DBGET integrated database retrieval system