KEGG   Solibacillus silvestris StLB046: SSIL_3690Help
Entry
SSIL_3690         CDS       T02162                                 

Definition
(GenBank) isopropylmalate/homocitrate/citramalate synthase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
siv  Solibacillus silvestris StLB046
Pathway
siv00360  Phenylalanine metabolism
siv00362  Benzoate degradation
siv00621  Dioxin degradation
siv00622  Xylene degradation
siv01100  Metabolic pathways
siv01120  Microbial metabolism in diverse environments
siv01220  Degradation of aromatic compounds
Module
siv_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:siv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    SSIL_3690
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SSIL_3690
   00622 Xylene degradation
    SSIL_3690
   00621 Dioxin degradation
    SSIL_3690
Enzymes [BR:siv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     SSIL_3690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm Glyco_trans_4_5
Motif
Other DBs
NCBI-ProteinID: BAK18113
UniProt: F2F483
Position
complement(3831643..3832638)
Genome map
AA seq 331 aa AA seqDB search
MRDIHILDVSLRDGSHSMKHQYSEQQVRDIARGLNQAGVEYFEVAHGDGLGGSSLQYGLS
AVDELKLIEAAANECTDSKVAVLLIPGIGIKDDLKNAVNAGAKMARVATHVTEADISAQH
IAYSRELELKTAGFLMMAHMAPTSVIVEQAKLFESYGAEIVYVTDSAGYLLPDQVTERIR
ALKENIGCEIGFHAHNNMSLAMANSLAAIEAGATYIDGSLRALGAGSGNTQTEVLVAVLQ
RMGIQTGVDLYNIIDVANDIVAPILPRPQEISGSSLIMGYAGVYSSFLLHTEKASKQFGV
DERDILVELGRRKTVGGQEDLIYEVAQSLRK
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgagagacattcatattttagatgtatcgttacgagacggcagtcactccatgaagcat
caatattccgagcaacaagtacgagatattgccagaggattaaatcaggcaggtgtagag
tattttgaagtcgcacatggtgatgggttaggcggatcgagcttgcagtacggtctatct
gctgtagacgaactgaagttaatcgaagcagctgccaatgaatgtaccgattcaaaagta
gctgtcttacttattcccggcatcgggattaaggatgatttaaaaaatgccgtgaatgca
ggcgcaaaaatggcacgtgttgcaacacatgtgacagaagccgatatttcagcacagcat
attgcctatagtcgtgaattggaactgaaaactgccggatttttgatgatggcacatatg
gcgccgacaagcgtcattgtcgagcaggctaaattatttgaaagttacggtgcagaaatc
gtgtatgtgacggattctgcaggttaccttttaccagatcaagtgacggaacgcattcgg
gcactgaaagaaaatatcggctgtgaaatcggattccacgcacataataatatgtcactg
gcgatggcgaactctttagcggcaattgaagcgggcgctacttatattgacggctcattg
cgtgcactgggggcaggcagcggcaatacgcaaaccgaagtattggttgctgtactgcag
cggatgggcattcaaacaggtgttgatttatataatattatcgatgtcgcaaatgacatc
gtcgcaccaattttacctcgccctcaggaaatatcaggttcgagcctaattatgggatat
gcaggcgtgtattcaagcttcctactacatacagaaaaagcttccaagcaattcggtgta
gatgaacgcgatattttagttgagctgggccgccgtaaaacagtcggcggacaagaagat
ttaatttacgaagtggcacagagtttgcggaaataa

DBGET integrated database retrieval system