KEGG   Solibacillus silvestris StLB046: SSIL_3691Help
Entry
SSIL_3691         CDS       T02162                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
siv  Solibacillus silvestris StLB046
Pathway
siv00360  Phenylalanine metabolism
siv00362  Benzoate degradation
siv00620  Pyruvate metabolism
siv00621  Dioxin degradation
siv00622  Xylene degradation
siv00650  Butanoate metabolism
siv01100  Metabolic pathways
siv01120  Microbial metabolism in diverse environments
siv01220  Degradation of aromatic compounds
Module
siv_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:siv00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SSIL_3691
   00650 Butanoate metabolism
    SSIL_3691
  Amino acid metabolism
   00360 Phenylalanine metabolism
    SSIL_3691
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SSIL_3691
   00622 Xylene degradation
    SSIL_3691
   00621 Dioxin degradation
    SSIL_3691
Enzymes [BR:siv01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     SSIL_3691
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh DapB_N F420_oxidored CoA_binding Rossmann-like 2-Hacid_dh_C NAD_binding_7 NAD_binding_3 GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: BAK18114
UniProt: F2F484
Position
complement(3832635..3833522)
Genome map
AA seq 295 aa AA seqDB search
MTKLKVGIIGSGNIGTDLMYKIERCDALEMAVMVGIDPQSEGLARARDRGYIAIENGIEG
FKSQLDLVDIVFDATSAYAHKENYEVIKAAGKKMIDLTPAAIGPFTVPPVNLSEHFEKDN
VNMVTCGGQATIPVVAAISRVVPVDYAEIVATVASKSAGPGTRANIDEFTRTTANAIEAV
GGAKKGKAIIILNPAEPPIMMRDTVHALVAETGKEDEIRASIKEMIEEVKTYVPGYRLCG
EPIFEGNKVSVLLEVEGIGDFFPPYSGNLDIMTAAAARVANELAKNLIAQGAVVR
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
ttgacgaaattaaaagtaggcattatcggttcagggaatatcggtacggatttaatgtat
aaaattgagcgttgtgatgcactggagatggcggtcatggtaggtattgatccgcaatca
gaaggtttggcacgtgcacgcgaccgtggctatattgcaatcgaaaatggtattgaagga
tttaaatcgcagttagatctagttgatatcgtttttgatgcgacgagtgcctatgctcac
aaagagaattatgaggttataaaagctgcaggtaaaaagatgattgatttaactccggca
gcaataggaccattcactgttccgccagtaaatttgagtgagcactttgaaaaagacaat
gtcaacatggtaacgtgcggcggtcaggcaacgattccggttgtggcagcgatttcccgt
gttgtgcctgtggactacgcagaaatcgtggcaacggttgcaagtaaaagtgcaggcccg
ggaacacgcgcaaatatcgatgaatttacacggacaacggcaaatgcaatcgaagcagtc
ggcggtgcgaaaaaagggaaagcaattatcattttaaacccggcagaaccgcctattatg
atgcgtgatacagtgcatgcgctcgtagcggagacagggaaagaagatgaaattcgcgct
tctattaaagagatgattgaggaagtaaaaacatacgtcccgggttaccgtctatgtggt
gaaccgatttttgaaggtaataaagtatcagttttattagaagtggaagggattggcgat
ttcttcccgccttattcaggaaatttggacattatgacggcagctgctgcacgtgtagca
aatgaattagccaaaaatctaatagcgcaaggagcggttgtgcgatga

DBGET integrated database retrieval system