KEGG   Sinorhizobium sp. RAC02: BSY16_1103
Entry
BSY16_1103        CDS       T04514                                 

Definition
(GenBank) molybdopterin-binding domain of aldehyde dehydrogenase family protein
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
six  Sinorhizobium sp. RAC02
Pathway
six00230  Purine metabolism
six01100  Metabolic pathways
six01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:six00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSY16_1103
Enzymes [BR:six01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     BSY16_1103
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C Peptidase_M24
Other DBs
NCBI-ProteinID: AOF88625
UniProt: A0A1B3M677
Position
1163963..1166269
AA seq 768 aa
MNINTPIEEREFKIVGKSVRRDDVLEKVTGEAEYTGDVKLAGMLYGKTKRATVAHARIKS
IDVSKALAYPGVKAVLTHENVPRVLHYGSPHPRSASCTKDQYILDDKVRFWGEGVAVVAA
ISEEIADEALDLIDVEYEALPAVFEPEDAAQPGAPLIHEVGPGGNLVLDPVRVNRGNVEA
GFAEADFVLEGTFSGGRPHPAYMEPNVCIADWDGSNKLTFWTSTQSSFMVRGILAEVLGL
PLTKVRVLVDHMGGGFGAKQDCFQHEFLCALLAKETRRPVKMEFTRHETFIAGRARHPCK
IWLKQGFKNDGTLVARDMKLVYDSGAYGSHGPGVTIVGTTAATSLYRCENVRLEGRCVYT
NTPINGAFRGYGVVQSYYALDIQMDEAAERLGMDPAELKLKNVVREGDIAPSGHPILGHG
LEICLQHGIDVLDWKKLRNRDRTPDPKQPHIRTGWGVGCEMHGSSAYPGIKEQGNATVKV
NEDGTVTLLTGAAGLGTGAHTALAQIVAEELGVRFEDVGTIHGDTDVVPWDIGAFASHTT
YLVGTAAKMAATKVRTSVLERAAMKVQVKADELDLSEGKIFVKAEPGRFMTVAEAMGPSR
GIPAANIVANGTYEPTKSYSFAAHFTEVHVDTETGIVEVKRVIPVHDIGRVIHPIAAQGQ
IEGGIQQGIGHTLTEDYVIDKKTGRSLNAGLVDYKMPLSMDMPDIETIILEAAPDPGGPW
GAKGVGEDPIIAIGPAIANAIHDAIGVRFHHYPITPEDILKALREKGA
NT seq 2307 nt   +upstreamnt  +downstreamnt
atgaacatcaacacccctatcgaagagcgcgaattcaagatcgtcggcaagagcgtgcgc
cgcgacgacgtgctggaaaaggtgacgggcgaggccgaatataccggtgacgtcaagctt
gccggcatgctgtacggcaagaccaagcgcgcgaccgtcgcccatgcgcgtatcaagagc
atcgatgtcagcaaggcgctcgcctatccgggcgtcaaggcggtgctgacgcacgaaaat
gtgccgcgcgtgctgcattacggctcgccgcatccgcgctcggcttcctgcaccaaggac
cagtatatccttgacgacaaggtgcgattctggggagagggcgtcgccgtcgttgctgcc
atcagcgaggagatcgccgacgaggcgctcgacctgatcgacgtcgaatacgaagccttg
ccggccgtcttcgagccggaagacgcggctcagccgggtgccccgctgatccacgaagtc
gggccgggcggcaacctggtgctcgatccggtacgcgtcaatcgcgggaacgtcgaggcc
ggttttgccgaggcggatttcgtgcttgaaggcacgttttccggcggtcgtccgcatcct
gcctatatggagccgaatgtctgtatcgcggactgggacggctcgaacaagctgaccttc
tggacctccacacagtcctccttcatggtgcgcggcatccttgccgaagtgctcggcctg
ccgctcaccaaggtgcgcgtgctcgtcgaccatatgggcggcggcttcggtgccaagcag
gactgtttccagcacgaattcctgtgtgcgctgcttgcgaaagagacgcgtcgtccggtg
aagatggaattcacccgtcacgagaccttcattgcgggccgtgcgcgccacccctgcaag
atctggctgaagcaaggcttcaagaacgacggcaccctcgtcgcccgtgacatgaagctg
gtctacgattcgggcgcctacggctcgcacggcccgggcgtgacgatcgtcggcaccacc
gccgccacctcgctctatcgctgcgagaacgtgcggctggaagggcgctgcgtctacacc
aatacgccgatcaacggtgctttccgcggctatggcgtggtgcagagctattatgcgctc
gacatccagatggacgaggcggccgaacggctgggcatggacccggcggagctgaagctg
aagaacgtcgtgcgggaaggcgacatcgcgccgtcaggtcatccgatcctcggccacggg
ctggaaatctgccttcagcacggcatcgacgtgctcgactggaagaagctgcgcaaccgc
gaccgcacgccggatcccaagcagccgcacatccgcaccggctggggcgtcggttgtgaa
atgcacggttcttccgcctatcccggcatcaaggaacagggcaacgccaccgtgaaggtc
aatgaggacggcacggtgacgctgctgacgggggcggccggcctcggcaccggcgcgcac
actgcgctggcacagatcgttgccgaagaactcggcgtgcgcttcgaggatgtcggcacg
atccatggcgatacggacgtggtgccatgggatatcggcgcctttgccagccacacgacc
tatctcgtcggcaccgccgccaagatggctgccaccaaggtgcgtacgtccgttctcgaa
cgggctgcaatgaaggttcaggttaaggccgacgaacttgacctttccgagggaaaaatc
ttcgtcaaggctgagcctggtcgcttcatgactgtcgccgaggcgatgggtccttcgcgt
ggcattcccgccgccaacatcgtcgcgaacggtacctacgagccgacgaaatcctattcc
ttcgccgcgcattttaccgaggtgcatgtcgatacggaaaccggcatcgtcgaggtcaag
cgcgtcataccggtgcacgatatcggccgggtcatccacccgatcgcggcgcagggccag
atcgagggcggcatccagcagggtatcggtcacacgctgaccgaggactacgtcatcgac
aagaagaccggccggtcgctcaatgccggcctcgtcgactacaagatgccgctctccatg
gacatgccggacatcgagacgatcatcctcgaagctgcacccgatccgggcggcccctgg
ggcgccaagggtgtcggcgaggacccgatcatcgccatcggcccggccatcgccaacgcc
atccacgacgccatcggcgtccgtttccaccactatccgatcactccggaagacatcctg
aaagcactgagggagaagggcgcatga

DBGET integrated database retrieval system