KEGG   Sinorhizobium sp. RAC02: BSY16_1936Help
Entry
BSY16_1936        CDS       T04514                                 

Gene name
dehII
Definition
(GenBank) haloacid dehalogenase, type II
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
six  Sinorhizobium sp. RAC02
Pathway
six00361  Chlorocyclohexane and chlorobenzene degradation
six00625  Chloroalkane and chloroalkene degradation
six01100  Metabolic pathways
six01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:six00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BSY16_1936 (dehII)
   00361 Chlorocyclohexane and chlorobenzene degradation
    BSY16_1936 (dehII)
Enzymes [BR:six01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     BSY16_1936 (dehII)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase HAD Hydrolase_6 Acid_PPase
Motif
Other DBs
NCBI-ProteinID: AOF90626
UniProt: A0A1B3MBV8
Position
2010520..2011170
Genome map
AA seq 216 aa AA seqDB search
MSHAAYVFDAYGTLFDVHAAVRRHAGDVGPNYQLFSEVWRAKQLEYSWTRALMGAYADFW
QLTEQALDFTFQRIGGVDPALRQKLLDAYWKLDCYPEVPAVLKALKQRGAHIAILSNGSP
AMLASAVKNAALDTVIDDIFSVDALKTYKTAPAVYDLVTTNYRLYPNAVSFQSSNRWDIA
GATKFGFRTVWINRSNMPDEYFDLGPALILPSLDSL
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgtcccacgccgcctatgtctttgacgcttacggcacgctgttcgacgtgcatgcggca
gtgcgccgccatgcgggcgatgtcgggccgaactaccagcttttctcggaagtctggcgc
gccaagcagctcgaatattcctggacgcgcgcgctgatgggcgcctatgccgacttctgg
cagctcaccgaacaggcgctcgacttcaccttccagcgcatcggcggcgtcgaccctgcg
ctgcgccagaaattgctcgacgcctactggaagctcgactgctacccggaagtgccggct
gtcctgaaggcgttgaagcagcggggcgcgcatatcgccatcctctccaacggctcgccc
gccatgctggcctccgccgtgaagaacgccgcgctcgacaccgtcatcgacgacatcttt
tccgtcgacgcgctgaagacctacaagacggcgcccgccgtctacgacctcgtgacgacc
aactaccggctctatccgaacgccgtctccttccagtcctccaatcgctgggacattgcg
ggggccacgaaattcggcttccgcaccgtctggatcaaccgcagcaatatgccggacgaa
tatttcgacctcggcccggcgctgatcctgccctcgctcgacagcctctga

DBGET integrated database retrieval system