KEGG   Sinorhizobium sp. RAC02: BSY16_2680Help
Entry
BSY16_2680        CDS       T04514                                 

Definition
(GenBank) acetyl-CoA C-acyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
six  Sinorhizobium sp. RAC02
Pathway
six00071  Fatty acid degradation
six00072  Synthesis and degradation of ketone bodies
six00280  Valine, leucine and isoleucine degradation
six00310  Lysine degradation
six00362  Benzoate degradation
six00380  Tryptophan metabolism
six00620  Pyruvate metabolism
six00630  Glyoxylate and dicarboxylate metabolism
six00640  Propanoate metabolism
six00650  Butanoate metabolism
six00900  Terpenoid backbone biosynthesis
six01100  Metabolic pathways
six01110  Biosynthesis of secondary metabolites
six01120  Microbial metabolism in diverse environments
six01130  Biosynthesis of antibiotics
six01200  Carbon metabolism
six01212  Fatty acid metabolism
six02020  Two-component system
Brite
KEGG Orthology (KO) [BR:six00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BSY16_2680
   00630 Glyoxylate and dicarboxylate metabolism
    BSY16_2680
   00640 Propanoate metabolism
    BSY16_2680
   00650 Butanoate metabolism
    BSY16_2680
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BSY16_2680
   00072 Synthesis and degradation of ketone bodies
    BSY16_2680
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BSY16_2680
   00310 Lysine degradation
    BSY16_2680
   00380 Tryptophan metabolism
    BSY16_2680
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BSY16_2680
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BSY16_2680
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSY16_2680
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:six04147]
    BSY16_2680
Enzymes [BR:six01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BSY16_2680
Exosome [BR:six04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BSY16_2680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AOF90634
UniProt: A0A1B3MBW6
Position
2774094..2775302
Genome map
AA seq 402 aa AA seqDB search
MTDVFIYDHVRTPRGRGKKDGSLHEVPSVRLAAKVLEAVRDRNGLDTAKVDDIVMGCVDP
VMDAGSVIPKAAAFEAGYSTKAPGIQLSRFCASGLDAVNLGAAKIAQGADDIVIAGGVES
MSRVGLGMSGGSWFMDPSVNFPAYFMPQGVSADLIATKYGFTRDDVDAYAVESQKRAAHA
WEKGYFKNAVVPVKDINGLTILAHDEHMRPGTDMQALASLNPSFQMPGEMGGFEAVAIQA
HPEIEGINYVHHAGNSSGIVDGAAAVLLGSKEGGNILGKKARGRIKAFANIGSDPALMLT
GPVDVTEKLLARAGMTLSDIDLFELNEAFAAVVLRYMQAFDIPHDKINVNGGAIAMGHPL
GATGAMILGTVLDELERRDLNTAVVTLCIGAGMGTATIIERV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgtcttcatctacgatcatgtgcgcaccccgcgcgggcgcggcaagaaggat
ggttcgctgcacgaagtgccgtccgtccgtctcgccgccaaggttctggaagcggtgcgt
gaccgcaacgggctcgatacggccaaggtcgacgatatcgtgatgggctgcgtcgatccc
gtcatggatgcgggctctgtcatcccgaaggccgccgccttcgaagccggctattcgacc
aaggcgccgggcattcagctgtcgcgtttctgcgcctccggcctcgacgccgtcaacctt
ggtgcggcgaagatcgcccagggcgctgatgatatcgtgatcgccggcggtgttgaaagc
atgtcccgcgtcggcctcggcatgtcgggcggctcgtggttcatggacccctcggtcaac
ttccccgcctatttcatgccgcagggcgtctcggccgacctcatcgccaccaaatacggg
tttacccgcgacgacgtcgacgcctatgccgtcgagagccagaagcgggcggcgcacgcc
tgggagaaaggctacttcaagaacgccgtcgtgccggtgaaggacatcaacggcctgacg
atccttgcccatgacgagcacatgcgccccggcaccgacatgcaggcgctcgcctcgctc
aacccctccttccagatgcccggcgagatgggcggcttcgaagccgtcgccatccaggcc
catccggaaatcgaaggcatcaactacgtccaccacgccggcaattcgtcgggcatcgtc
gatggcgctgccgccgtgctgctcggctcgaaagagggtggcaacatcctcggcaagaag
gcgcgcggccgcatcaaggctttcgccaatattggttccgatccggccctcatgctgacc
ggcccggtcgacgtcacggaaaagctgctcgcccgcgccggcatgacgctttccgacatc
gacctcttcgagctcaacgaagccttcgccgccgtggttctgcgctacatgcaggccttc
gacatcccgcacgacaagattaacgtcaacggcggcgccatcgccatgggccatccgctc
ggcgccacgggtgcgatgatcctcggcacggtgctcgacgaactggaacgccgcgacctc
aacaccgccgtcgtcacgctctgcatcggcgccggcatgggcacagcgacgatcatcgaa
cgggtctga

DBGET integrated database retrieval system