KEGG   Sinorhizobium sp. RAC02: BSY16_2698Help
Entry
BSY16_2698        CDS       T04514                                 

Definition
(GenBank) hypothetical protein
  KO
K06195  ApaG protein
Organism
six  Sinorhizobium sp. RAC02
Brite
KEGG Orthology (KO) [BR:six00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    BSY16_2698
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AOF88518
UniProt: A0A1B3M5Y4
Position
2793378..2793770
Genome map
AA seq 130 aa AA seqDB search
MYRALTRDIEVTVEPYYLADQSDPDDSRYVWGYRVVISNHSDVAVRLMTRYWHITDQNGQ
VDEVNGPGVIGEQPTLRPGDTYEYSSGCPLETPSGIMFGRYRMEAENGEAFDVAIPAFSL
DTPGQPRTLN
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtatcgtgcgctaacccgcgacatcgaagtgaccgtagagccgtactatctggccgac
cagtccgaccccgatgatagccgctatgtctggggttaccgcgtcgtcatatccaaccat
tccgacgtcgccgtgcggctgatgacacgctactggcacatcaccgaccagaacggccag
gtcgacgaggtcaacggtcccggcgtcatcggtgaacaaccgacgctgcgccccggcgat
acctacgagtactcttcaggctgcccgctcgaaacaccgtccggcatcatgttcggccgc
taccgcatggaggcggagaacggcgaagccttcgacgtcgccattcctgccttctcgctg
gatacaccaggacaaccgcgcaccctcaactga

DBGET integrated database retrieval system