KEGG   Sinorhizobium sp. RAC02: BSY16_3786Help
Entry
BSY16_3786        CDS       T04514                                 

Definition
(GenBank) beta-galactosidase
  KO
K05350  beta-glucosidase [EC:3.2.1.21]
Organism
six  Sinorhizobium sp. RAC02
Pathway
six00460  Cyanoamino acid metabolism
six00500  Starch and sucrose metabolism
six01100  Metabolic pathways
six01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:six00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BSY16_3786
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    BSY16_3786
Enzymes [BR:six01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     BSY16_3786
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-ProteinID: AOF88609
UniProt: A0A1B3M684
Position
3930742..3932115
Genome map
AA seq 457 aa AA seqDB search
MIDPKTLAERFPGDFVFGVATAAFQIEGATNLDGRKPSIWDAFSNMPGRVFGRHNGDVAC
DHYNRLEQDLDLIQSLGVEAYRFSIAWPRIIPEGTGPVNEKGLDFYDRLVDGLKARGIKA
FATLYHWDLPLMLAGNGGWTARSTAYAFQRYAKTAIARLGDRLDAVATFNEPWCSVWLSH
LYGIHAPGERNMDAALYALHVTNLAHGLGVAAIRSERPDLPVGLVLNAHQTYAGSDSAAD
QAAAARAFDFHNGIFFGPVFKGEYPESFLSALGHRMPQIEPGDMETISQPLDWWGLNYYT
PMRVSHDPSEGAVFPATLPAPPVADVQTDIGWEVYAPALGDLIRKLNAAYALPDCYITEN
GACYNMGVENGMVDDQPRLDYIAEHLGVTADLIGEGYPMRGYFAWSLMDNFEWAEGYRMR
FGIVHVDYDTQVRTIKKSGQWYGELAGQFPKGNHRTA
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatcccaagacccttgccgagcgttttcccggtgatttcgtgttcggcgtggcg
acagccgccttccagatcgagggcgcgacgaatttggatggccgcaagccgtcgatctgg
gatgccttttccaacatgcccggccgggtcttcggccggcacaatggcgatgtcgcctgc
gatcattacaatcgcctggagcaggatctggacctcatccagtcgctcggcgtcgaggcc
tatcgcttctccatcgcctggccgcgcatcattccggagggcaccgggccggtgaacgag
aaggggctggatttctacgaccgcctcgtcgatggtctgaaggcgcgcggcatcaaggcc
ttcgccacgctctaccattgggacctgccgctgatgctggccggcaatggcggctggacg
gcgcggtcgacggcctatgccttccagcgctatgcaaaaaccgccatcgcccgcctcggc
gaccggctggatgcggtggcgaccttcaacgagccctggtgctccgtctggctcagccat
ctctacggcattcacgcgcccggcgaacgcaacatggatgcggcgctatacgctctgcat
gtcaccaacctggcgcacggccttggcgtcgcggccatccgttccgagcggccggatctg
ccggtcggcctcgtgctgaatgcccaccagacctatgccggcagcgacagcgcggcggac
caggccgctgccgcccgcgccttcgatttccacaacggcatcttcttcggcccggtcttc
aagggcgaatatccggaaagcttcctctccgcgcttggtcatcgcatgccgcagatcgag
ccgggcgacatggaaacgatcagccagccgctcgactggtgggggctgaactactacacg
cccatgcgggtttcgcatgatccgtcggaaggcgccgtcttccccgccacgctgcccgcg
ccgcccgttgccgacgtccagacggatatcggctgggaagtctatgcgccggcgcttggc
gatctcatccgcaagctcaatgcggcctatgcgctgccggattgctacatcacggaaaac
ggcgcctgctacaatatgggcgtcgaaaacggcatggtcgacgaccagccgcgcctcgac
tacatcgctgaacatctcggtgtcaccgccgacctgatcggcgagggttatccgatgcgc
ggttacttcgcctggagcctgatggacaatttcgaatgggcggaaggctaccgcatgcgc
ttcggcatcgtgcatgtcgactacgacacgcaggtgcgcacgataaagaagagcggccaa
tggtacggtgaactcgccggccagtttccgaagggcaaccaccggacggcctga

DBGET integrated database retrieval system