KEGG   Sinorhizobium sp. RAC02: BSY16_5570Help
Entry
BSY16_5570        CDS       T04514                                 

Definition
(GenBank) beta-eliminating lyase family protein
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
six  Sinorhizobium sp. RAC02
Pathway
six00260  Glycine, serine and threonine metabolism
six01100  Metabolic pathways
six01110  Biosynthesis of secondary metabolites
six01120  Microbial metabolism in diverse environments
six01130  Biosynthesis of antibiotics
six01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:six00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BSY16_5570
Enzymes [BR:six01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     BSY16_5570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Cys_Met_Meta_PP DegT_DnrJ_EryC1 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AOF93043
UniProt: A0A1B3MIU8
Position
pBSY16_1:1679621..1680691
Genome map
AA seq 356 aa AA seqDB search
MPEHPRLIDLSADTATRPSEAMRLAICAAPVGDEQRGEDPTTLALEERVANLLGQQKALF
LPSGTMANQIAFIVHCRPGDEIICAENAHVFGSEGAGAAVLAGAQFRPLDTATGIFTAED
VASRLRAPRHRSPRSRVITIEQTTNRGGGRIWSEDAIRALKGLALENGLALHMDGARLLN
AAVATGLPAARFAAPCDSVWIDLSKGLGCPVGAVLAGSTGFIEEALVWKHRLGGAMRQSG
ILAAAGLYALDHNVERLAEDHDNAWRLAAILAAVPGLQVQPGGAVTNILFLDLLGTGVSA
SALAEALAGEAIRVNVEGQHRIRMVTHLDVSADDVEVAGWAIVAALARLRPDQSGG
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgccagagcaccctcgccttatcgacctgagcgccgacaccgcgacacggccgtccgag
gccatgcgcctggccatctgcgccgcgccggtgggtgacgagcagcggggcgaggatccg
acgacgctggcactggaggagcgcgtcgccaaccttctcgggcagcaaaaggccttgttc
ctgccttccggcaccatggcgaaccagatcgcctttatcgtgcactgccgaccgggggac
gagatcatctgcgcggagaacgcccatgtattcggctcggagggggcgggagccgccgtg
cttgccggcgcacagtttcggccgctcgacacggccaccggcatctttacggccgaggac
gtcgcaagccgcctgcgggcgccgcgccaccgctcgccacgcagccgggtcatcaccatc
gagcagaccaccaatcggggcggtggccgaatctggtcggaagatgcgatacgcgcgttg
aaggggctggcgctggaaaatgggctcgcgttgcacatggatggggcacggttgctgaat
gcggcggtggccacgggcctgccggcggcgcgtttcgcggcaccctgcgacagcgtctgg
atcgatctttccaaagggttgggatgcccggtcggagcggtgctggcgggatccaccgga
tttatcgaggaggcgttggtctggaagcaccgtttgggcggagcgatgcggcagtccggc
attcttgctgctgcgggtctctatgcgctggatcacaatgtcgagcgacttgcggaggat
catgacaatgcctggcgccttgcggcaatcctcgcagcggtgcccggacttcaagtgcag
ccggggggcgctgtcaccaacattctctttctcgacctcttggggacgggtgtttcggca
agcgcgctggcggaagcgcttgccggcgaggcgatccgcgtcaatgtcgaaggccagcac
cgcatccgcatggtcacccaccttgatgtctcggccgacgacgtggaggtcgctggatgg
gcaatcgtcgcggcgctggcgcgcctgcggcccgatcaatcgggcggttga

DBGET integrated database retrieval system