KEGG   Sinorhizobium sp. RAC02: BSY16_5700Help
Entry
BSY16_5700        CDS       T04514                                 

Definition
(GenBank) hypothetical protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
six  Sinorhizobium sp. RAC02
Pathway
six00051  Fructose and mannose metabolism
six01100  Metabolic pathways
six01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:six00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BSY16_5700
Enzymes [BR:six01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     BSY16_5700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II DOG1
Motif
Other DBs
NCBI-ProteinID: AOF93529
UniProt: A0A1B3MK85
Position
pBSY16_1:complement(1832291..1832938)
Genome map
AA seq 215 aa AA seqDB search
MMEELAARETLVEASRRSVAIGLNSGTVGNFSVRHGAGMLITPTGIVPDVLSPEQIVAMD
LAGHWVGDWRPSSEWAIHARLYATTTAGAVVHAHPDHCVALAALRQPIPLFHYMVAGFGG
GEIPCADYACFGSEALSETVVAAMGTTYSACLMANHGVVTIGPDITIALARAEKLEMLAR
QYVLARSVGQPVLLTPEELVDVRARYGTYGQQATR
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgatggaagaattggcagcaagagagacgctggtcgaggctagccggcgatcggtggcc
atcggcctcaacagcggcacggtgggcaacttcagcgtcaggcatggcgcgggaatgttg
atcacgccgaccggtattgtgccggatgtgctttcgccggagcagatcgtcgcgatggat
ctagcgggccattgggtgggcgactggcgcccgtcttcggaatgggcgatccacgcgcgg
ctctatgccacgacgacggcgggtgctgtcgtgcacgcccatcccgaccattgcgtcgcc
ctagcggcactgcgccagcccatcccgctgttccactacatggtcgctggcttcggcggc
ggcgagataccgtgtgccgactatgcctgtttcggcagcgaggcgctgtcggaaaccgtg
gtcgccgccatgggcacgacctattccgcctgcctgatggccaatcatggcgtggtgacg
atcggacctgacattaccattgcgctcgcaagggcggaaaaactggaaatgctggcgcgc
cagtacgtgctcgcccggtcggtcggccagccggtgctgctgacgccggaagagctggtg
gacgtgcgcgcccgctacggcacctacggccagcaggcgacgcgctga

DBGET integrated database retrieval system