KEGG   Sulfolobus islandicus Y.G.57.14: YG5714_2379Help
Entry
YG5714_2379       CDS       T00901                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K19588  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
siy  Sulfolobus islandicus Y.G.57.14
Pathway
siy00040  Pentose and glucuronate interconversions
siy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:siy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    YG5714_2379
   00053 Ascorbate and aldarate metabolism
    YG5714_2379
Enzymes [BR:siy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     YG5714_2379
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: ACP46625
UniProt: C3N9Q3
Position
2133610..2135046
Genome map
AA seq 478 aa AA seqDB search
MKSYQGLADKWIKGSGEEYLDINPADKDHVLAKIRLYTKDDVKEAINKAVAKFDEWSRTP
APKRGSILLKAGELMEQEAQEFALLMTLEEGKTLKDSMFEVTRSYNLLKFYGALAFKISG
KTLPSADPNTRIFTVKEPLGVVALITPWNFPLSIPVWKLAPALAAGNTAVIKPATKTPLM
VAKLVEVLSKAGLPEGVVNLVVGKGSEVGDTIVSDDNIAAVSFTGSTEVGKRIYKLVGNK
NRMTRIQLELGGKNALYVDKSADLTLAAELAVRGGFGLTGQSCTATSRLIINKDVYTQFK
QRLLERVKKWRVGPGTEDVDMGPVVDEGQFKKDLEYIEYGKNVGAKLIYGGNIIPGKGYF
LEPTIFEGVTSDMRLFKEEIFGPVLSVTEAKDLDEAIRLVNAVDYGHTAGIVASDINAIN
EFVSRVEAGVIKVNKPTVGLELQAPFGGFKNSGATTWKEMGEDALEFYLKEKTVYEGW
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcgtatcagggattggctgacaagtggattaagggcagtggggaagaatacctt
gatattaatccggctgataaggatcacgtattagctaagataagattatatacaaaagat
gacgttaaagaagctataaacaaggctgtagccaaattcgacgaatggtcaaggactcca
gcacctaaaagaggctcaatattacttaaggcaggggaattaatggaacaagaagcccaa
gagtttgcgctattgatgacattagaggagggtaagactctcaaggatagtatgtttgaa
gtgacaagaagttataatttactgaaattttatggagcattagcatttaagatatctggg
aaaacgcttccttcagcagatcctaatactaggatatttacagtaaaggaacccttaggc
gtagtagctttaattacgccgtggaatttcccattatcaataccagtatggaaattggct
ccagccttggctgcgggtaacactgcagtaataaaaccagcgacgaaaacaccgttaatg
gtagccaaattggtagaagtattgtctaaagctggattgccagagggtgtcgtgaattta
gtagttggtaagggaagtgaagtcggagataccatagtaagtgatgataatatagctgca
gtatcatttactggatcaaccgaggtaggtaagagaatttacaaactcgtaggaaataaa
aatagaatgacaagaattcaactagagctaggaggtaaaaacgcgttatatgtggataag
agcgctgacttaacgttagctgctgaattagccgtaagaggaggatttggactaaccggt
caatcatgtactgcaactagtaggttaataattaacaaggatgtatatactcaatttaaa
caaagactactagaaagagttaagaagtggagagtaggaccgggtactgaagatgttgat
atgggtccagttgtagatgaaggtcaatttaagaaagacttagaatatatagaatacgga
aagaatgtgggagcaaaactaatttatggtggaaatataataccagggaagggatatttc
ctagaacctacaattttcgaaggagtcacatctgatatgaggctatttaaagaagagatt
ttcggtccagtacttagtgtcactgaggcaaaagatttagatgaggctataaggctagtt
aacgctgtagactatggacatacggctggaatagtcgcaagcgatatcaatgcgattaac
gagttcgttagtagggtagaggcaggagttataaaggttaataagccaacagtcggactg
gaattgcaagcaccatttggtggttttaagaattctggagccactacgtggaaagagatg
ggagaagatgctttagagttctaccttaaggagaagacagtatacgaaggctggtaa

DBGET integrated database retrieval system