KEGG   Shewanella japonica: SJ2017_1108Help
Entry
SJ2017_1108       CDS       T04959                                 

Definition
(GenBank) Aminoglycoside phosphotransferase
  KO
K07102  N-acetylmuramate 1-kinase [EC:2.7.1.221]
Organism
sja  Shewanella japonica
Pathway
sja00520  Amino sugar and nucleotide sugar metabolism
sja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SJ2017_1108
Enzymes [BR:sja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.221  N-acetylmuramate 1-kinase
     SJ2017_1108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: APH Choline_kinase
Motif
Other DBs
NCBI-ProteinID: ARD21439
Position
1325535..1326533
Genome map
AA seq 332 aa AA seqDB search
MTLSDTRFILLRKWLSQYFKTEVEIELICGDASFRRYFRVKHLAKSYIVSDSPIELVPIQ
PFIDMAISYQKVGLVVPEIIAQDNVSGFVLQSDLGDEQLINQLNLQTVKPLYTQALGLLP
KIAQVKATASGELPLYDRQFVERELAIFSEWLLGTHLKLTLSDHDKQIISHAFSVLIENA
IAQPHVGMHRDYHSRNILLVDKQLGVIDFQDAVIGPVTYDAVSLLRDCYIKWPKDIVDEL
KQSHFRLCQQHQFIDESVSFEQYESWFDLMGLQRHIKAAGIFARLHHRDAKPGYLKDIPL
TLTYIVEVSALYPQLEEFGLWVKERVIPLISK
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgactttatctgatacaagatttattttacttaggaagtggttaagtcaatattttaag
acagaagtcgagatagaactaatctgtggagacgcaagttttcgccgttattttagagtt
aaacatttagcaaagtcttatatagtctcagattcaccgatcgagcttgtgccaatacaa
ccttttattgatatggcaatttcgtatcaaaaagtcggattagttgtacctgaaattatt
gctcaagataatgtgtcaggatttgttttgcagtctgatttaggtgatgagcagctaatt
aatcagttaaacctgcaaacagttaagccgctttatactcaagcactcggattactacct
aaaattgcgcaagtcaaagccaccgcctctggtgagctgcctttatatgatcgtcaattt
gttgaacgtgaattagcgatttttagtgaatggctgttaggaacacatctgaaattaact
ttatcagaccatgataagcaaattatctcacacgcatttagtgtgctgatagaaaatgct
atcgctcagccacatgtcggcatgcatcgagattatcatagccgcaatattttactggtg
gataagcaactcggtgtgattgattttcaagatgcagtgataggccctgtgacttatgat
gccgtgtctcttttacgagattgctatatcaaatggccaaaagacatcgttgatgagtta
aagcaatctcattttcgtctttgtcagcagcatcagttcattgatgagtctgtgtcattt
gagcagtatgagtcttggtttgatttaatgggattacaacgccatatcaaagccgcaggt
atttttgcaaggttacatcaccgagatgcaaaaccaggttatttaaaagatattccgtta
acactcacttatatcgtcgaggtctcggcgctttatcctcagctagaagagtttggctta
tgggttaaagagcgagtgatccctctgatatcaaagtaa

DBGET integrated database retrieval system